(data stored in ACNUC30630 zone)

EMBL: CP000580.PE462

CP000580.PE462       Location/Qualifiers
FT   CDS_pept        complement(514287..514751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96275"
FT                   /protein_id="ABN96275.1"
FT                   /translation="MTDGREFDDDELAALASFTPRFDEDADDDLDALGVYTSTGPDDND
FT                   DPAQDLIFVAANPSGTVTVTALLGGECQCVDLAPTVTALTETELAAEIVAVAQVAAQRA
FT                   GAGAYELFAAMFRAQGEDRASVDDLLRHQLRLPTPDEARASAAELAARSR"
     gtgacagacg gtcgggagtt cgacgacgac gaactggccg ccctcgcctc gttcacgccg        60
     cggttcgacg aggacgccga cgacgatctc gacgccctgg gcgtctatac ctcgaccggc       120
     ccggacgaca acgacgaccc cgcacaggat ctgatcttcg tcgcggcgaa tccgtccgga       180
     accgtgacgg tcaccgccct gttgggcggc gaatgccaat gcgtcgacct ggcgcccacg       240
     gtgacggcgc tgaccgagac cgaactcgcc gctgagatcg tggccgtcgc gcaggtggcg       300
     gcacagcggg cgggcgctgg ggcgtacgaa ctgttcgccg cgatgttccg cgcgcagggc       360
     gaggaccggg cgtcggtcga cgatctcctg cggcaccaac tgcggttgcc gacgccagac       420
     gaggcacgcg cctccgcggc cgagttggcc gctcgctccc gctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page