(data stored in ACNUC30630 zone)

EMBL: CP000580.PE469

CP000580.PE469       Location/Qualifiers
FT   CDS_pept        521298..522194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96282"
FT                   /protein_id="ABN96282.1"
FT                   /translation="MRALVAVVVTVLLVAVTGCSKAEGRSDTYSAPTAKVGESLAVSGW
FT                   NISVSNLRFEADHVLVDVDASHSGEGEPVAPESLRFGLYGALVHPIEANGLGSCQNVDA
FT                   LNVNPVSAPSPDRLSGTVCLGPQRDQSQVRGIYAYSPQDRMAGTTVAYAAAFPVGLLPT
FT                   RDTETGLTLKTTSLDAFRADGAQLNQAALGDPEAFSGNGYMLLGLQIDGLASRYREDSM
FT                   RRGGPLMVVVAPTLPGKGLSYACAAYGASVLVLPEASREAVNMRASLCTQGEINRALLF
FT                   ASVSVVGTHAALWTTGD"
     gtgcgcgcgc tcgtcgccgt cgtcgtgacg gttctgctcg ttgcggtcac cggctgctcg        60
     aaggccgagg gccggtccga cacctactcc gcgccgacgg cgaaagtcgg tgagtccctg       120
     gcagtctcgg gatggaacat ctcggtgtcg aatctgcgct tcgaggccga tcacgtcctc       180
     gtcgacgtcg acgcctcgca ttcgggcgag ggcgaaccgg tcgcgccgga gtcgctgcgg       240
     ttcggcctct acggcgcgct ggtgcacccg atcgaggcga acgggctcgg cagctgccag       300
     aacgtcgacg cgctcaacgt caacccggtg tccgcgccga gccccgaccg gctcagcggc       360
     acagtgtgtc tgggtccgca gcgtgaccag agccaggtgc gtggcatcta cgcgtactca       420
     ccgcaggacc ggatggccgg gaccacggtc gcctacgccg cggcgttccc cgtcggcctg       480
     ctgcccaccc gtgacaccga aaccggcctc acgctcaaga cgaccagcct cgatgcgttc       540
     cgcgccgacg gcgcacagct gaaccaggcc gcgctgggtg acccggaagc cttcagcggc       600
     aacggttaca tgctgctcgg cctccagatc gacgggctgg cgagccgcta ccgggaggac       660
     tccatgcgcc ggggcggccc gctgatggtc gtcgtcgcac cgacgttgcc gggtaaggga       720
     ctgagctacg cgtgtgcggc gtacggggca tcggtgctgg tgctcccgga ggcgtcccgc       780
     gaggcggtga acatgcgcgc ctccctgtgc acgcagggtg agatcaaccg cgcgctgctg       840
     ttcgcctcgg tgtcggtggt cgggacccac gccgcgctgt ggaccaccgg tgactga          897
//

If you have problems or comments...

PBIL Back to PBIL home page