(data stored in ACNUC30630 zone)

EMBL: CP000580.PE475

CP000580.PE475       Location/Qualifiers
FT   CDS_pept        complement(527939..528895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0476"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mmc:Mmcs_0487 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96288"
FT                   /protein_id="ABN96288.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAEELGMSDAGISMHVTQLRKELDD
FT                   PLFSRTSAGLAFTPGGLRLASRAIEILGLQQQTAIEVTEAAHGRRLLRIAASTMFAEHA
FT                   APGLIELFSARADDLTVELSVHPTSRFRDLIESRAVDITLGPAPADPGPALVVRPFLKY
FT                   QIITVAAPETAAGPGMQAPAQLREHDWMLGPSAGGVDGEVATMLRNLSIPESRQRIFQS
FT                   EAAALEEVQRAGGVTLTLGFAVSRDLSSRRLVQIKGAGLQTSGEWFASTLTPAARPPAS
FT                   SELMRFITTPRCTQAMIRGTGVGVTRFKPKVHVTLWS"
     gtgacacccg ctcagctccg tgcctattcg gcggtggtgc gactgggttc cgtgcgtgcg        60
     gccgccgagg aactcggcat gtcggacgcg ggaatctcca tgcacgtcac acagctgcgc       120
     aaggaactcg acgatccgct gttcagccgc acgtcggccg ggctggcgtt cactcctgga       180
     ggccttcggc tcgccagccg tgccatcgag atcctggggc tgcagcagca gaccgccatc       240
     gaggtgaccg aagcggccca cggcaggcgg ttgctgcgca tcgccgcgtc gacgatgttc       300
     gccgaacacg ccgcgcccgg cctgatcgag ttgttctccg cgcgcgccga cgatctcacg       360
     gtggaactgt ctgtgcaccc caccagccgg ttccgcgacc tgatcgagtc acgcgccgtc       420
     gacatcacgc tgggccccgc acccgctgac cccggccccg ccctcgtggt acgccccttt       480
     ctcaagtacc agatcatcac cgtcgccgcc cccgagaccg ccgcgggccc gggcatgcag       540
     gcacccgcgc agctgcgcga gcacgactgg atgctggggc cgtcggccgg cggcgtcgac       600
     ggtgaggtcg ccacgatgct gcggaacctg tcgatcccgg agtcgcggca gcgcatcttc       660
     cagagcgagg cggccgcact cgaggaagtg cagcgcgccg gcggcgtgac gctgaccctc       720
     ggcttcgcgg tgtcgagaga tctttcgtcg cgccgactgg tgcagatcaa aggagcgggc       780
     ctgcagacgt ccggggagtg gttcgcttcg acgctcaccc cggcggcgcg cccaccggca       840
     tcatcggaac tgatgcgttt catcaccact ccccgctgca cacaggcgat gatccgcggc       900
     accggtgtcg gcgtcacccg cttcaaaccg aaggtgcatg tgacgctctg gagttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page