(data stored in ACNUC30630 zone)

EMBL: CP000580.PE482

CP000580.PE482       Location/Qualifiers
FT   CDS_pept        535652..536320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0483"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mmc:Mmcs_0494 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96295"
FT                   /protein_id="ABN96295.1"
FT                   /translation="MKIANEFTVGVPIEQAWDVLTDLEQVIPLMPGAAMTGRDGDDVMG
FT                   KVKVKVGPVTSEFNGKVHFVEQNRAEHRAVIDGRGKEARGTGNAAATVTAQLHPDGDRT
FT                   RVTVDTDLKIVGKLAQFGSGMLQQVSEKLLGQFVESLEAKLAGDATPPAAAQEVATPVA
FT                   GGDGDAPRPQVVPAPPAEAPPIDLLELAGGGAVKKYGPPAVGALLLLVLLLVALRRRRR
FT                   "
     atgaagatcg ccaatgaatt cacagtcggt gtgccgatcg agcaggcctg ggacgtgctg        60
     accgacctcg agcaggtcat cccgctgatg ccgggtgcgg cgatgaccgg acgcgacggc       120
     gacgacgtga tgggcaaggt caaagtcaaa gtgggaccgg tgaccagtga attcaacggg       180
     aaggtgcact tcgtcgagca gaaccgcgcc gagcaccgcg cggtcatcga cggccgcggc       240
     aaggaagccc gcggcacggg caacgccgcg gcgacggtca ccgcgcaact gcatcccgac       300
     ggggaccgca cccgcgtcac cgtcgacacg gatctgaaga tcgtgggcaa gctcgcgcag       360
     ttcggcagcg gcatgctgca gcaggtttcg gaaaaactgc tcggccagtt cgtcgagtcg       420
     ctggaagcca aactcgcggg cgacgcgact ccgcccgccg ccgcccagga ggtcgcgaca       480
     cccgtcgccg gcggtgacgg cgatgcgccc aggccgcagg tggtgccggc cccgccggcc       540
     gaggcgccgc ccatcgacct gctcgaactc gccggcggcg gagccgtcaa gaagtacggt       600
     ccaccggccg tcggcgcgct gctgctcctg gtgctgctgt tggtggcgct gcgtcgacgg       660
     cggcgatga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page