(data stored in ACNUC30630 zone)

EMBL: CP000580.PE484

CP000580.PE484       Location/Qualifiers
FT   CDS_pept        537579..538433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0485"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0496
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96297"
FT                   /protein_id="ABN96297.1"
FT                   /translation="MLSGMDQYRRDGLVFEVRDEGPADGPVVVLLHGFPQRNTSWDAII
FT                   ERLTAQGYRCLAPNQRGYSPGARPRRRRDYRIPELIADVGALIDASGAERVHLVGHDWG
FT                   AAVAWGVAAEMPERLATVVPVSVPHPAAFLKSIPTSRQGLASWYMYFFQLPYVPELLLT
FT                   RRRGALALGALRRTGQSEAAAERDVAAMLDPGALTAGLNWYRAMPFMDPRATGGKITVP
FT                   TMFVWSDRDSALLPKGAYDTARYVSGEYRFEIMSGASHWLPEERADELAALLLEWFDAH
FT                   PIT"
     atgctgagcg gtatggatca gtaccggcgc gacggcctgg tgttcgaggt gcgggacgag        60
     gggccggccg acggcccggt tgtggtgctg ctgcacggtt tcccgcagcg caacaccagc       120
     tgggacgcca tcatcgagcg gctcaccgca cagggctacc gctgcctggc gccgaatcag       180
     cgcgggtatt cgccgggcgc gcggccccgg cggcggcgcg actaccgcat cccggagctg       240
     atcgccgacg tcggggcgct gatcgacgcc agcggcgccg aacgcgtgca tctcgtgggt       300
     cacgactggg gcgccgcggt cgcgtggggg gtcgccgcgg agatgcccga gcggctcgcc       360
     acggtggtcc cggtgtcggt gccgcatccg gcggcgttcc tcaagtcgat tccgaccagc       420
     cggcagggcc tggcgtcctg gtacatgtac ttcttccagc tgccctatgt gcccgaactg       480
     ctgctgaccc ggcgacgcgg ggcgctggcg ctcggtgcgt tgcgccgcac gggccagagc       540
     gaggctgccg ccgaacgcga cgtcgccgcg atgctcgatc ccggtgcgct gaccgccggc       600
     ctcaactggt accgcgctat gccgttcatg gatccgcgcg cgaccggcgg caagatcacg       660
     gtcccgacga tgttcgtgtg gagtgaccgg gattcggcgc tgctgcccaa gggcgcctac       720
     gacaccgccc gctacgtctc cggcgagtac cgcttcgaga tcatgtccgg cgcgtcgcac       780
     tggctgcccg aggaacgcgc cgacgaactc gccgccctgc tgctggagtg gttcgacgcc       840
     cacccgatca cctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page