(data stored in ACNUC30630 zone)

EMBL: CP000580.PE5

CP000580.PE5         Location/Qualifiers
FT   CDS_pept        5614..6186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   mmc:Mmcs_0005 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95818"
FT                   /protein_id="ABN95818.1"
FT                   /translation="MSDDDRDGDGDPIGPPAHLSELKGMDLVRRTLEEARGAARSQGKD
FT                   VGRGRTSPARRVAGTGRRRSWSGPGPDSRDPQTLGAATRDLARTRGWSPKVAEGAVFGQ
FT                   WSTVVGEQIAEHATPSSLREGVLTVAAESTAWATQLRMVQSQLLAKIAAAVGDGVVTSL
FT                   KITGPTAPSWRKGRYHIAGRGPRDTYG"
     atgagcgacg acgaccggga tggcgacggc gacccgatcg gtccccccgc gcacctgtcc        60
     gagctcaagg gcatggatct ggtgcggcgc accctcgaag aagcccgcgg ggcggcgcgc       120
     agccagggta aggacgtggg ccggggtcgg acctcgccgg cccgccgggt ggcgggtacg       180
     ggacggcgcc gcagctggtc gggacctggt ccggattccc gcgaccccca gacactcggt       240
     gcggcgacgc gggatctggc ccgtacccgg ggctggtccc ccaaggtcgc cgagggtgcg       300
     gtgttcggac agtggtcgac ggtggtcggc gaacagatcg ccgaacacgc caccccgagt       360
     tcgttgcgcg agggcgtcct gacggtcgcc gccgaatcga ccgcctgggc cacccaactc       420
     cggatggtgc agtcgcagct tctggcgaag atcgccgcgg ccgtcggcga cggtgtcgtc       480
     acctcgctga agatcaccgg gccgacggcg ccgtcgtggc ggaaaggccg ttaccacatc       540
     gcgggccgcg gcccgcgcga tacgtacgga tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page