(data stored in ACNUC30630 zone)

EMBL: CP000580.PE500

CP000580.PE500       Location/Qualifiers
FT   CDS_pept        553000..554400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0501"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0512 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96313"
FT                   /protein_id="ABN96313.1"
FT                   /translation="MIDSRTAPTASEVLARLHAEDIATVILGGTDTHGVMRGKRVPISQ
FT                   LPRMLEHGMPMCDVFWVMHVDESDLVARPDGYRGYFPTERQGYPDILAVPDLTTLRIVP
FT                   WHNDTALLLCDWELPADHRPVPIAPRSVLRRVVERADAMGYRPLSALELEFYLLREKAG
FT                   TTHRKRADELVPLQEAPSTYGVVMGSLQEDIGALIRRHMLDYGLPVEACNPETGPGQFE
FT                   ITLRYGNSLKSADDAFLFKSAVKEVAAQNDLLATFMAKPVTDWAGNSCHVHLSLRDIAG
FT                   GGVFFDQDAPDQLSTALRHFAGGILHTMREFTALMAPTPNSYRRFVPYSWAGTTATWGV
FT                   DNRSVGLRVIREGDHGTRVEHRQPGGDANPYLATAAALAGGLHGLLNEIEPRELSTTDI
FT                   YSQPSEDLPVLPATLAEAVDLLADSAAAREWFGDDFVDHYVLMKRAEIAAQSVAVTDWE
FT                   VARYLEAM"
     atgatcgact cacgcaccgc ccccaccgcc tcggaggtcc tcgcccgact gcacgccgag        60
     gacatcgcga cggtgatcct cggcggcacc gacacccacg gggtgatgcg cggcaagcgg       120
     gtcccgatca gccagctgcc ccggatgctc gagcacggga tgccgatgtg cgacgtgttc       180
     tgggtgatgc acgtcgacga atccgacctc gtcgcacgcc ccgacggata ccgcggatac       240
     ttccccaccg aacggcaggg ctaccccgac atcctggccg tccccgacct gaccaccctg       300
     cggatcgtgc cctggcacaa cgacaccgcg ctgttgctgt gtgactggga gctgccggcc       360
     gaccaccggc cggtgcccat cgcgccgcgg tcggtgctgc gccgcgtcgt cgaacgtgcc       420
     gacgcgatgg gctaccggcc gctgagcgcg ctggagttgg agttctatct gctgcgcgag       480
     aaggcgggca ccacgcaccg caaacgggcc gacgaactcg tcccgctgca ggaggcgccc       540
     agcacctacg gcgtggtgat gggttcgctg caggaggaca tcggagcgct gatccggcgc       600
     cacatgctcg actacggcct gcccgtcgag gcctgcaacc ccgagacggg tcccgggcag       660
     ttcgagatca cgctgcggta cggcaacagc ctgaagtccg ccgacgacgc cttcctgttc       720
     aagtcggcgg tcaaggaggt cgccgcccag aacgacctgc tcgcgacgtt catggcgaaa       780
     cccgtgaccg actgggcggg taacagctgc cacgtgcacc tgagcctgcg cgacatcgcc       840
     gggggcgggg tcttcttcga ccaggacgcc cccgatcagc tctccaccgc gctgcgccac       900
     ttcgccggcg gaatcctgca caccatgcgg gaattcaccg cgctgatggc gccgacaccg       960
     aactcctacc gccgcttcgt gccgtactcg tgggccggca ccaccgccac ctggggtgtc      1020
     gacaaccgtt cggtcggctt gcgcgtcatt cgcgaaggcg accacggcac ccgcgtcgag      1080
     caccgtcagc ccggtggtga cgccaacccg tatctggcca ccgccgccgc cctcgcgggc      1140
     ggactgcacg gactgctcaa cgagatcgaa ccccgcgaac tgtccacgac cgacatctac      1200
     agccagccga gcgaggatct gccggtcctg cctgccaccc tcgccgaggc ggtggacctg      1260
     ctcgcggaca gcgcggcggc acgggagtgg ttcggggacg acttcgtcga ccattacgtg      1320
     ctgatgaagc gcgcagagat cgcggcccag tcggtggcgg tcaccgactg ggaggtcgcc      1380
     cggtacctcg aggcgatgta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page