(data stored in ACNUC30630 zone)

EMBL: CP000580.PE521

CP000580.PE521       Location/Qualifiers
FT   CDS_pept        571736..572746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0522"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0532
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96334"
FT                   /protein_id="ABN96334.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWR
FT                   HEGGHAPFSLAWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMACLYPDRIFLG
FT                   VGTGEALNEIATGYEGDWPDFKERFARLRESVRLMRELWLGDRVDFDGEYYRTKGASIY
FT                   DVPEGGVPVYIAAGGPVVAKYAGRAGDGFICTSGKGEELYKDKLLPAVAEGADAAGKNV
FT                   DDVDKMIEIKISYDTDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADELPIEQVA
FT                   KRWIVASDPDEAVEKVKDYVGWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLG"
     atggctgaac tcaaactcgg atacaaagcg tcggcggagc agttcgcgcc gcgggaactg        60
     gtcgaactcg cggtggcggc cgaagagcac ggtatggaca gtgcgacggt cagcgaccac       120
     ttccagccgt ggcgccacga gggcggacat gcgccgttct cgctggcgtg gatgaccgcg       180
     gtgggggagc ggaccaagcg gttgcagttg ggcacctcgg tgctcacacc gacgttccgc       240
     tacaacccgg cggtgatcgc gcaggcgttc gcgacgatgg cctgtctgta tccggaccga       300
     atcttcctcg gtgtcggcac cggtgaggcg ctcaacgaga tcgcgaccgg ttacgagggc       360
     gactggccgg acttcaagga gcggttcgcg cggctgcgcg agtcggtgcg gttgatgcgt       420
     gagttgtggc tcggcgaccg cgtcgacttc gacggcgagt actaccgcac caagggtgcg       480
     tcgatctacg acgtccccga aggcggcgtc ccggtgtaca tcgccgcggg cgggccagtg       540
     gtggcgaagt acgccggccg cgcgggggac ggtttcatct gcacctccgg taagggtgag       600
     gaactgtaca aggacaagct gctgcccgcg gtggccgagg gagccgatgc ggccgggaag       660
     aacgtcgacg atgtcgacaa gatgatcgag atcaagatct cctacgacac ggatcccgaa       720
     ctggcgctgg agaatacgcg gttctgggcg ccgctgtcgt tgaccgccga acagaagcac       780
     agcatcgacg acccgatcga gatggagaag gccgccgacg agttgccgat cgagcaggtc       840
     gccaagcggt ggatcgtcgc ctcggatccg gatgaggccg tcgagaaggt caaggactac       900
     gtcgggtggg gcctgaacca cctcgtgttc cacgcacccg gccacgacca gcgccggttc       960
     ctcgagctct tcaaacggga tctggagccg cggctgcgca agctgggctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page