(data stored in ACNUC30630 zone)

EMBL: CP000580.PE522

CP000580.PE522       Location/Qualifiers
FT   CDS_pept        complement(572750..574402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96335"
FT                   /protein_id="ABN96335.1"
FT                   /translation="MTAGAPRRIWGVALFAALSALYFTVGAVLVLRFNMFDPDSPSRVA
FT                   NAGYVLMSRQPHLSAIGFVWNPLPSLVEIPVLTLADWWPALKTHGLAGVVQSALFMAGA
FT                   AVMVRRIALDRGVGTVWRWLAVGCFALHPMFVTYGASGMSEAAETFALVWCVRHLMQWA
FT                   HSHRVGDLAWAGIALGVGYLSRYEAVPAACGAALLVAVVAFHRAQRGQRVNSVILNVLI
FT                   VMFPLISAFAIWALTGWVVSGELFATLSSQYGNDSQVAAAMDRASPLAGAASDDWVVIA
FT                   ARLLGMQPFVLIATAGAVAFAVLRRNATALVPVATLGPVLAFAAWGQFTSTTFGWFRFY
FT                   LLAIPLVICVALAFWQPGARRAVTVARSDVRAGRVGAGLLCASLVIGIPVTVTAMSDER
FT                   IGNQQLQFGLKSLTDPQRYPPTEQWYRRLMVNDRALAAYFDRKRLPEGAVLMDTFNTWG
FT                   VWLGSQRPKQFVITSDYDFTATLNRPWDFGVQYLVASNPGISNADALNIRYPTLWQDGA
FT                   GLGTLVHSVYGATGDERFRVYRVTGRPAPPTAG"
     gtgacggcgg gcgccccgcg gcgcatctgg ggcgtcgcac tgttcgccgc gctcagcgcg        60
     ctgtacttca ccgtcggcgc ggttctggtc ctgcggttca acatgttcga ccccgattcg       120
     ccgagccggg tggccaacgc cggatacgtg ctgatgagcc ggcagccgca cctgtcggcg       180
     atcgggttcg tgtggaaccc gctgccgagc ctggtcgaga tcccggtgct gacgctcgcc       240
     gactggtggc cggcgctcaa gacccacggc ctcgcggggg tcgtgcagag cgcgttgttc       300
     atggcgggcg ccgcggtgat ggtgcggcgc atcgcactcg accgcggcgt cggcacggtg       360
     tggcggtggc tggccgtcgg gtgtttcgcc ctgcacccga tgttcgtcac ctacggcgcc       420
     tccgggatga gcgaggcggc cgagacgttc gccctggtgt ggtgcgtccg ccatctcatg       480
     cagtgggcgc actcgcaccg ggtcggcgat ctcgcctggg cgggaatcgc tctcggcgtc       540
     ggatacctgt cgcgctacga ggcggtgccc gcggcgtgcg gggcggcgct gttggtggcc       600
     gtggtcgcat tccaccgtgc gcagcggggt cagcgggtga actcggtgat cctgaacgtc       660
     ctgatcgtga tgttcccgct catctcggcg ttcgcgatct gggcgctgac cggatgggtg       720
     gtgtccggtg aactcttcgc gaccctgtcc tcgcagtacg ggaacgacag tcaggtcgcc       780
     gcggcgatgg accgggcgag cccgctggcg ggagcggctt ccgacgactg ggtggtgatc       840
     gcggcgcggc tcctcggcat gcagccgttc gtgctgatcg ccacggcggg cgcggtggcg       900
     ttcgccgtcc tccgccgcaa cgccaccgcc ctcgtcccgg tcgccaccct cgggccggtg       960
     ctggccttcg ccgcatgggg tcagttcacc tcgaccacgt tcggctggtt ccggttctac      1020
     ctgctcgcga ttccgctcgt gatctgtgtc gcgctggcgt tctggcaacc gggcgcccgg      1080
     cgcgcggtca ccgtcgcacg gtccgacgtg cgggcgggcc gcgtcggcgc ggggctgctg      1140
     tgcgcatcgt tggtcatcgg tatcccggtc accgtgacgg cgatgtccga cgaacgaatc      1200
     ggcaaccagc agttgcagtt cgggctcaag tcgctgaccg acccgcagcg gtatccaccc      1260
     accgaacagt ggtaccggcg gctgatggtc aacgaccgcg cactggccgc ctacttcgac      1320
     cgcaagcgcc tgcccgaggg cgcggtgctg atggacacct tcaacacgtg gggtgtctgg      1380
     ctcggttcgc agcggccgaa gcagttcgtc atcaccagcg actacgactt caccgcaacg      1440
     ctcaaccgcc cgtgggactt cggcgtgcag tacctggtcg cgagcaaccc cgggatcagc      1500
     aacgcggacg cgctgaacat ccggtacccg accctgtggc aggacggcgc cgggctgggc      1560
     acgctcgtgc actcggtgta cggcgcgacc ggcgacgaac gtttccgcgt ctaccgggtg      1620
     accggccggc ctgcgccgcc gacggcggga tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page