(data stored in ACNUC30630 zone)

EMBL: CP000580.PE543

CP000580.PE543       Location/Qualifiers
FT   CDS_pept        599023..600462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0544"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mmc:Mmcs_0554 lysyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96356"
FT                   /protein_id="ABN96356.1"
FT                   /translation="MRISRAVTALVAALVAACSSPAPPPDVTGGDLAGKVTVDALYTHL
FT                   EALQDIAERHGGNRAQGTAGFDASVDYVANLLRDSGFDVQTPEFDRYGGTRGGAPRLTV
FT                   NGRAHAVEKASLLVDTGPEGLDAVTLRPGRPAGCSAGDYGGVDVRRSIVVVDDTGCSVV
FT                   VKQDVAVARGAVGVLVVTGSGGGSPPGLFTPGYYRELTVPVGIINSDANAALRRTTAPV
FT                   RLRLDGQPVLVKSRNVLAQTKTGDTRNVVMAGAHLDSVSSGPGINDNATGVAAVLETAL
FT                   QLGSSPRVANAVRFAFWGSEEIGLEGSRAYLRDLDGEQLDDIALYLNFDMLGSTNAGYF
FT                   TYDGDQSAATEPVSVPEGSAGVERLLAGYLNEAGVRPADMPLSDRTDYHSFLAAGVPFG
FT                   GTTTGAAQQKTEVQARLWGGRAGAAFDPNYHTRRDTIDNVDRHALGIMGPAVAFAVGTY
FT                   AHSIEGVNGVPPRDRRDRDRP"
     atgcgcatca gccgggcggt cacagcgctg gtggcggcgc tggtcgcggc gtgctcgtca        60
     cccgccccgc cgccggatgt cacgggcggt gatctggcag gcaaggtcac cgtcgacgcg       120
     ctctacaccc acctcgaggc gctgcaggac atcgccgaac gtcacggcgg gaaccgcgcg       180
     caggggacgg cggggttcga cgccagcgtc gactatgtgg ccaatctgct gcgagacagc       240
     ggtttcgatg ttcagacccc tgagttcgac cgctacggtg gcacgcgtgg tggtgcacca       300
     cggctgaccg tgaacggccg cgctcatgcg gtggagaagg cgtcgctgct ggtggacacc       360
     ggacccgagg gcctcgatgc ggtcaccctg cgcccgggcc ggcccgccgg ctgcagcgcc       420
     ggcgattacg gcggagtcga cgtccgtcgt tcgatcgtgg tggtcgacga cacggggtgc       480
     tcggtggtgg tcaagcagga cgtcgccgta gccaggggcg cggtgggggt gctggtggtc       540
     accggcagtg gcggcggcag cccaccgggg ctgttcacac ccgggtacta ccgtgaactc       600
     accgtcccgg tggggatcat caactcggac gcgaacgccg cactgcgccg tacgaccgca       660
     ccggtgcggt tacgtctgga cggacagccg gtgctggtga aatcacggaa cgtcctggcc       720
     cagacgaaga ccggcgacac ccgcaatgtc gtgatggccg gcgcacatct cgacagcgtg       780
     tcgagcgggc cggggatcaa cgacaatgcc accggtgtgg ccgcggttct ggagacggcc       840
     ctgcagctgg gtagttcacc gcgggtcgcc aacgccgtgc ggttcgcgtt ctggggttcc       900
     gaggagatcg gcctcgaagg atcacgggcc tacctccgcg acctcgacgg cgaacaactc       960
     gacgacatcg cgctgtacct caacttcgac atgctcgggt cgaccaacgc gggatacttc      1020
     acctacgacg gggatcaatc cgcggccacc gaaccggtgt cggtgccgga gggatcggcg      1080
     ggcgtcgaac gcctgctcgc gggatacctc aacgaggcgg gtgtgcggcc cgccgacatg      1140
     ccgctgagcg accggaccga ctaccactcg tttctggccg ccggcgtgcc gttcggcggt      1200
     acgaccaccg gtgcggcgca acagaagacc gaggtgcagg cgcggctctg gggcggacgg      1260
     gccggcgcgg cgttcgaccc gaactatcac acccgtcgcg acaccatcga caacgtggac      1320
     cgtcacgcgc tgggaatcat gggtccggcg gtggccttcg cggtcggcac ctatgcgcac      1380
     tccatcgagg gcgttaacgg ggtgccgccg cgcgaccgac gcgaccgtga caggccgtag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page