(data stored in ACNUC30630 zone)

EMBL: CP000580.PE544

CP000580.PE544       Location/Qualifiers
FT   CDS_pept        600952..602256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96357"
FT                   /protein_id="ABN96357.1"
FT                   /translation="MQTAVRSYVSAGVALAGVGAIAFSPVVPIPDVEVPAISSSAVELN
FT                   ALVNPIELFVPIFEKAFADTGALGQRVFANPAPILEQILANQVASAQTLGEIAGVFGES
FT                   FQTAFAAAPGLLETAFDQFAAGEITLALNTLFDLALSPVIGPLLDSIFMGDGVLQDLVG
FT                   VLQKPLVNAQNVIGLLGDPDFLLTIGLLPLQTAYALNTAVGGAAEALLAAAEAGDPEGF
FT                   VNAITTGSANVTAAVLDLLLNPGTPPYNYDQGLVAALLSARDMIAQAIGAPAPSPALLA
FT                   TVSSEVTDPALTTITLDVAPASDAIEAPKPAAETDVSAVSLSADAVDATEPATAVAEET
FT                   AAVEAGVDEVVAESEVVTPKKSDPLNELRKGVEGAVNDIRNGFKHAAASLTGKASKPAK
FT                   SESSPASDSGSASESDSGSDSGSGSGSDSTSGDAE"
     atgcagaccg ctgttcgctc gtacgtgtcg gcaggtgtcg ccctcgccgg tgtcggcgcc        60
     atcgccttca gcccagtggt gccgattccg gacgtcgagg tgccggcgat ctcgtcgtcg       120
     gccgtcgagc tcaacgcgct cgtcaacccg atcgagctct tcgtgccgat cttcgagaag       180
     gcgttcgcgg acaccggcgc gctcggtcag cgggtcttcg cgaatcccgc gccgatcctg       240
     gagcagatcc tggccaacca ggtcgccagc gcccagacgc tcggcgagat cgccggggtg       300
     ttcggggagt ccttccagac ggcattcgcg gccgccccgg gactgctcga gaccgcattc       360
     gatcagttcg cggccggtga gatcaccctg gcgctgaaca ccttgttcga cctcgcgctc       420
     tcgccggtca tcgggccgct gctggacagc atcttcatgg gggacggggt cctccaggac       480
     ctcgtgggcg tcctccagaa accgttggtc aacgcccaga atgtgatcgg cctactcggt       540
     gaccccgact tcctgctgac catcggactc ctccccctgc agacggcgta tgcgctcaac       600
     accgccgtcg gcggagcggc cgaagcgctc ctcgccgccg ccgaagccgg agatcccgag       660
     gggttcgtca atgcgatcac caccggtagt gcgaatgtca ccgcggcagt gctggaccta       720
     ctcctcaacc cgggcactcc gccgtacaac tacgaccagg gtctcgtcgc tgcgcttctg       780
     agcgcccgcg acatgatcgc ccaagccatc ggcgcgcccg caccgagccc agcgctgttg       840
     gcaacagtga gctcggaggt gaccgatccg gcgctgacga ccatcacgtt ggacgtcgcg       900
     cctgcatcgg acgccatcga ggccccgaaa cccgctgccg aaactgatgt ttcagccgtc       960
     agcctcagcg ccgatgcggt cgatgccacg gagcccgcga cggcggtggc cgaggagacg      1020
     gctgcggtcg aggccggtgt cgatgaggtc gtcgcggaat ccgaggtcgt cacgccgaag      1080
     aagtcggatc cgctcaacga gcttcgcaag ggcgtcgaag gcgccgtcaa cgacatccgc      1140
     aacgggttca agcacgccgc ggcgagcctc accggcaagg cgagcaagcc cgcgaagtcg      1200
     gaaagttccc cggcgtccga cagcggctcg gcgtccgaga gcgactcggg gtcggactcg      1260
     ggcagcggtt cggggtccga ctcgacgtcg ggcgacgccg agtag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page