(data stored in ACNUC30630 zone)

EMBL: CP000580.PE55

CP000580.PE55        Location/Qualifiers
FT   CDS_pept        59236..60711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0055"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0065 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95868"
FT                   /protein_id="ABN95868.1"
FT                   /translation="MASFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   GAGIIIAVLICLGAALMAYFKPLGKRGGDQLLVDRSTNQLYVVMPGGGELRPVYNLTSA
FT                   RLVLGNPGTPVAVKSEELNRMSKGQPIGIPGAPYATPVSGAAESMWTLCDTVTKPESVV
FT                   PRVETSVLVRPLVVDSTVGPLRPDQGMLVSFKGANWLVTEGGRHSIDLADRAVTSAVGI
FT                   PVTARATPISEGLFNALPNAGPWQLPQVARAGEPNTVGLPANLVIGSVFETVTESDDQQ
FT                   HYVVLADGVARVNDPTAAALRATNSYGLIEPPMVEASVVARIPEQVYVSPLPDKALDIL
FT                   LRQDDPTLCWSWQRVAGDQAPRTTVIAGRRLPIAASALNTGIRQITGDSTVYIDGGQFI
FT                   RLQSPDPRYGESLYYIDPQGVRYGVTDEETAKNLGLVGPLTAPWQVVSLLVDGPVLSKQ
FT                   AALLEHDTLPANPNPRKVGEDGPVAGARPGGSR"
     atggcgagtt tccggcttac caccaaggtg caggtcagcg gttggcgctt cctgctgcgc        60
     cgggtcgagc acgcgatcgt gcgccgcgac acccggatgt tcgacgatcc gctgcagttc       120
     tacagccgcg cggtgggcgc gggcatcatc atcgcggtgc tgatctgtct cggcgcggcg       180
     ctgatggcgt acttcaaacc gctgggcaag cgcggcggtg accagctgct cgtcgaccgc       240
     agcaccaacc agctctatgt ggtgatgcct ggcggcgggg aactgaggcc ggtgtacaac       300
     ctcacctcgg cgcggctggt cctcggcaac cccggaaccc cggtcgcggt gaaatccgaa       360
     gagctgaacc ggatgtcgaa gggacaaccg atcggcatcc ccggcgcgcc ctatgcgacg       420
     ccggtctccg gtgcggccga gtcgatgtgg accctgtgcg acaccgtcac caaaccggag       480
     agcgtggtcc cgagggtgga gacgtcggtc ctggtgcgcc cgctggtggt cgactcgacc       540
     gtcgggccgc tgcgtccgga ccagggcatg ctggtgtcgt tcaagggtgc caactggttg       600
     gtgaccgagg gtggccgaca ctcgatcgac ctggccgacc gtgcggtgac gtcggccgtc       660
     gggatcccgg tgacggccag ggcgaccccg atctccgagg ggctgttcaa cgccctgccg       720
     aacgccgggc catggcaact gccccaggtg gcccgcgccg gcgaacccaa taccgttggg       780
     ctgcctgcga acctggtgat cggctcggtg ttcgagacgg tgaccgaatc cgacgatcag       840
     cagcactacg tcgtgctggc cgacggggtg gcccgcgtca acgacccgac cgccgcagcg       900
     ctgcgcgcca ccaactccta cggtctgatc gagccgccga tggtggaagc cagtgtggtg       960
     gcgcggattc cggagcaggt ctacgtctca ccgctgcccg acaaggcact cgacatcctg      1020
     ctgcgccagg acgatccgac gctgtgctgg tcgtggcagc gcgtcgcagg cgatcaggcg      1080
     ccccggacga cggtcatcgc cggccggcga ctgccgatcg ccgcgtcggc gttgaacacc      1140
     ggcatccggc agatcaccgg cgactccacc gtgtacatcg acggcgggca gttcatccgg      1200
     ttgcagtcac cggatccccg gtacggcgag agcctctact acatcgaccc gcagggcgtg      1260
     cgctacggcg tcaccgacga ggagaccgcc aagaatctcg gcctggtcgg accgctgacc      1320
     gcgccgtggc aggtggtcag cctgctcgtc gacggacccg tgctgtcgaa gcaggccgca      1380
     ctgctcgaac acgacaccct gcccgcgaac cccaacccgc gcaaggtcgg cgaggacggt      1440
     ccggtggcgg gcgcccgacc gggaggcagc cgatga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page