(data stored in ACNUC30630 zone)

EMBL: CP000580.PE561

CP000580.PE561       Location/Qualifiers
FT   CDS_pept        618473..619159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0562"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: mmc:Mmcs_0572 superoxide dismutase, copper/zinc
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96374"
FT                   /protein_id="ABN96374.1"
FT                   /translation="MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEG
FT                   GSGSEGQGEGGQKLTAELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHV
FT                   HQVGKCEPNSVAPSGGAPGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTT
FT                   DAFTAEDLTGGEGTAIIIHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACG
FT                   VIRSGQ"
     atgttcgccg ttcccgcgct cgcgctgagc gcctgcagtc ccaacgagcc ggtgtccagc        60
     gagccgggca ccacgccgtc ggtgtggacc ggttcgccgt ctccctcggc ggcgcccgga       120
     cagggcgaag aaggcgggag cggatcggaa ggccagggcg agggtggtca gaagctgacc       180
     gccgagctca agagcccgga cggcaccacc gtggcgaatg cggagttcga cttcagcggc       240
     ggctatgcca ccgtcaccgt ccagaccgtc gcttcgggcc agctggaacc ggggttccac       300
     gggatgcacg tccaccaggt cggcaagtgc gagccgaatt cggtcgctcc cagcggcggt       360
     gcgccgggca acttcaactc cgcgggcggg cacttccaga ccgagggcaa gaccgggcac       420
     ccggccagcg gtgacctcac ctcgctgcag gtccgcgagg acgggtcggc gatggtggtg       480
     accaccaccg atgcgttcac cgccgaggat ctgaccggcg gtgagggcac cgcgatcatc       540
     atccacgaga aggccgacaa cttcgcgaac atcccgccgg agaagtacaa ccaggtcaac       600
     ggcaccccgg gcccggacca ggcgaccatg gccaccggtg acgccggtgg gcgggtggcg       660
     tgcggtgtta tccgttccgg ccagtag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page