(data stored in ACNUC30630 zone)

EMBL: CP000580.PE587

CP000580.PE587       Location/Qualifiers
FT   CDS_pept        642420..642917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0588"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mmc:Mmcs_0597
FT                   membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96400"
FT                   /protein_id="ABN96400.1"
FT                   /translation="MEYAPLVLADPEHRPSAKAPLLWAASAALPWLVLVVAQVAWWVTD
FT                   PASGWLHAVAAAGTVLGIVLFVGVVPVWRYRVHRWAVDARAVYTRTGWLTQERRIAPIS
FT                   RVQTVDTQRGPLDRMFGLSSVTVTTASSAGAVRIVALDAPVAERIVAQLTDIAALGEQD
FT                   AT"
     atggagtacg cgcccctcgt tctggcagat cccgagcacc ggccgagcgc caaggcgcct        60
     ctgctgtggg cggcgtccgc ggcgctgccg tggctggtgc tcgtggtggc gcaggtggcc       120
     tggtgggtga ccgacccggc gtcggggtgg ctgcacgccg tggcggcggc gggcacggtg       180
     ctcggcatcg tgctgttcgt cggcgtcgtt ccggtatggc gttatcgggt gcaccgctgg       240
     gccgtcgacg cgcgtgcggt gtacacgcgg accgggtggc tgacgcagga gcggcggatc       300
     gcgccgatct cccgcgtgca gaccgtcgac acccagcgcg gtccgctgga ccggatgttc       360
     gggttgtcca gtgtgacggt gacgacggcg tcgtcggccg gggccgtgcg catcgtcgcg       420
     ctcgatgccc cggtggccga acggatcgtc gcgcagctga ccgacatcgc ggcgctcggc       480
     gaacaggatg cgacgtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page