(data stored in ACNUC30630 zone)

EMBL: CP000580.PE588

CP000580.PE588       Location/Qualifiers
FT   CDS_pept        642914..644374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0589"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: mmc:Mmcs_0598
FT                   membrane-flanked domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96401"
FT                   /protein_id="ABN96401.1"
FT                   /translation="MTAPAPQPQWLRLSPRMLLVHPVHEVLRQVPVLIGSVVLGSATGN
FT                   PWWAVAALVGTVGVGIARWFTTTYRIDAEEVQLRAGVLQRRVLSVPRNRIRSVSTDARL
FT                   LHRVLGLAVLRVSTGQEARGDDAFALDAVEAAQVPHLRAELLAESLTIAADSEHRGRVL
FT                   ASWQPAWLRYSPLSFTGLAMIAAAAGLLYQAGAGVLLRDSSLAEGGRGVAERFGVAATV
FT                   AVVVLAVLVGSVVLSVLRSLVTYGNLLLRRDGEVLHLEHGLLRRQEHTYDMRRLRGGTL
FT                   REPLLVRAFGGARLDAVMTGVGGEGEASLLLPPCPAATARAVLSDLIADEEEVAGPLRS
FT                   HGVAAARRRWTRALAVPVAMGVALVVATVLTAPPIWLWAVWAVLAVCCALLAADRVRSL
FT                   GHRAGDGWLVARTGSLERRRDCIAGPGIIGWTVQQTFFQRRSGVATLIAATAAGEKAYR
FT                   VVDVPADAAWSIVAAASPWVRDVPWARD"
     gtgacggccc cggcgccaca accgcaatgg ctgcggttga gcccccgcat gctgctggtc        60
     catccggtgc acgaggtgct gcggcaggtt ccggtgctga tcgggtcggt ggtgctcggc       120
     tccgcgaccg gcaatccgtg gtgggcggtc gccgccctgg tggggacggt cggcgtcggg       180
     atcgcgcggt ggttcaccac gacctaccgg atcgacgccg aggaggtgca gcttcgcgca       240
     ggtgtcctgc aacgccgggt cctgtcggtg ccgcgcaaca ggattcggtc ggtctccacc       300
     gatgcccgcc tgctgcaccg ggtgctcggc ctggccgtgc tgcgcgtgag caccggacag       360
     gaggcgcgcg gtgacgacgc gttcgcactc gacgccgtcg aggccgccca ggtcccgcat       420
     ctgcgggccg aactgctggc cgagtcgctg accatcgccg ccgactccga acaccggggg       480
     cgggtgctgg ccagctggca gccggcgtgg ctgcggtaca gcccgctcag cttcaccggt       540
     ctggcgatga tcgccgccgc ggcgggtctg ctgtaccagg cgggagccgg tgtgctgctg       600
     cgggattcga gcctggccga gggcggacgc ggcgtcgccg agcggttcgg cgttgcggcg       660
     accgtggccg tcgtcgtact ggccgtgctg gtcgggtccg tggtgctgtc ggtgctccgg       720
     tccctggtga cgtacggaaa cctgttgttg cggcgcgacg gtgaggtgct gcatctcgaa       780
     cacggtctgc tgcgtcgaca ggaacacacc tacgacatgc gccggctccg cggcggcacg       840
     ttgcgggagc cgctgttggt cagggcgttc ggtggtgcgc ggctggacgc ggtgatgacc       900
     ggggtgggcg gtgagggcga ggcgtcgttg ttgttgccgc cctgcccggc cgcgacggcc       960
     cgggcggtgc tcagtgatct catcgccgat gaggaggagg tcgccggacc gctgcgcagc      1020
     cacggggtgg ccgcggcgcg gcggcggtgg accagggcgc tcgccgtgcc ggtggcaatg      1080
     ggggtcgcgc tggtggtggc gaccgtcttg acggcgccgc cgatctggct gtgggcggtg      1140
     tgggcggttc tcgcggtgtg ctgcgcgctg ctggccgccg accgggtccg ctcgctcggg      1200
     caccgggccg gcgacggctg gctggtggcg cgcaccggca gcctcgagcg ccgccgcgac      1260
     tgcatcgccg gtccgggcat catcggctgg acggtgcaac agacgttctt ccagcggcgg      1320
     tccggggtgg cgacgctgat cgccgccacc gccgcggggg agaaggccta ccgggtcgtc      1380
     gacgtccccg ccgatgcggc gtggtcgatc gtcgcggcgg cgtcgccgtg ggtgagggat      1440
     gtcccctggg cgcgtgattg a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page