(data stored in ACNUC30630 zone)

EMBL: CP000580.PE6

CP000580.PE6         Location/Qualifiers
FT   CDS_pept        6407..8434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mmc:Mmcs_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95819"
FT                   /protein_id="ABN95819.1"
FT                   /translation="MAAQKKNAPAEYGADSIKVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VWEVVDNAVDEAMAGFATKVEVRILENGGVQVTDDGRGIPVAMHSTGIPTVDVVMTVLH
FT                   AGGKFEEGAYQVSGGLHGVGVSVVNALSTRLEADIRTDGYEWFQTYDRSVPGTLKQGEK
FT                   TKKTGTTIRFWADPDIFETTSYDFETIARRLQEMAFLNKGLTIELTDERVTAEEVVDDV
FT                   VSDHAEAPKSAEEKSAEAAKPQKVKHRVFHYPGGLVDFVKHINRTKTPIQPSVIDFDGK
FT                   GEGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRTALTSVVNKYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSQPQFEGQTKTKLGNTEVKSFVQKICNEQLSHWFEAN
FT                   PAEAKTVVNKAVSSAQARLAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLIENGHVFLAQPPLYKLKWQRS
FT                   TPEFAYSDRERDGLLEAGRAAGKRINADDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   ITLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
     gtggctgccc agaagaagaa tgctccggcc gagtacggcg cggattcgat caaggtcctc        60
     gaggggctcg aagcggtccg caagcgaccg ggcatgtaca tcggctcgac gggcgaacgc       120
     ggtctccacc acctggtctg ggaagtcgtc gacaacgccg tcgacgaggc gatggccggt       180
     ttcgccacca aggtcgaggt gcggatcctc gagaacggcg gcgtccaggt caccgacgac       240
     ggtcgtggca tcccggtcgc catgcactcc accggcatcc ccaccgtcga cgtcgtgatg       300
     accgtcctgc acgccggcgg caagttcgaa gagggcgcct accaggtgtc cggcggtctg       360
     cacggtgtgg gtgtgtcggt ggtcaacgcg ctgtccaccc ggctcgaggc cgacatccgc       420
     accgacgggt acgagtggtt tcagacctac gaccgttcgg tgccgggcac cctcaagcag       480
     ggtgagaaga cgaagaagac cggcacgacc atccgcttct gggccgatcc ggacatcttc       540
     gagaccacca gctacgactt cgagacgatc gcccggcgtc tgcaggagat ggcgttcctc       600
     aacaagggcc tcaccatcga attgaccgac gagcgggtga ccgccgaaga ggtggtcgac       660
     gacgtcgtca gcgatcatgc cgaagcgccc aagagcgccg aggagaagtc ggccgaggcg       720
     gcaaaaccgc agaaggtcaa gcaccgggtc ttccactacc cgggcggtct ggtcgacttc       780
     gtcaagcaca tcaaccgcac gaagaccccg atccagccca gcgtcatcga cttcgacggt       840
     aagggcgagg gccacgaggt cgagatcgcg atgcagtgga acgccggcta ctccgagtcg       900
     gtgcacacgt tcgccaacac gatcaacacc cacgagggcg gcacccacga agaggggttc       960
     cgcacggcgc tgacgtcggt ggtgaacaag tacgccaagg acaagaagct cctcaaggac      1020
     aaggatccga acctcaccgg cgacgacatc cgggagggcc tcgctgccgt catctcggtg      1080
     aaggtgtccc agccgcagtt cgaaggccag acgaagacca aactcggcaa caccgaggtc      1140
     aagtcgttcg tgcagaagat ctgcaacgaa cagctcagcc actggttcga ggccaatccg      1200
     gccgaggcga aaaccgttgt gaacaaggcg gtctcgtcgg cgcaggcgcg gctggccgcc      1260
     cgcaaggccc gggagttggt gcggcgcaag agcgcaaccg acatcggcgg tcttccgggc      1320
     aagctcgccg actgccgttc gaccgatccg agcaagtcgg aactgtatgt ggtggagggt      1380
     gactcggccg gcggttcggc caagagcggt cgcgactcga tgttccaggc gatcctgccg      1440
     ttgcgcggca agatcatcaa cgtcgagaag gcgcgcatcg accgcgtgct gaagaacacc      1500
     gaagtccagg cgatcatcac cgcgctgggc acgggtatcc acgacgagtt cgacatcagc      1560
     aagctgcggt atcacaagat cgtgctgatg gccgacgcag acgtcgacgg ccaacacatc      1620
     tcgacgctgc tgctgacact gctgttccgg ttcatgaaac cgttgatcga gaacggtcac      1680
     gtgttcctgg cgcagccgcc gctgtacaag ctcaaatggc agcgcagcac accggaattc      1740
     gcctattcgg accgggagcg cgacgggttg ctcgaagccg gccgtgccgc gggcaagcgg      1800
     atcaacgccg acgacggcat ccagcgctac aagggtctgg gcgagatgga cgccaaggaa      1860
     ctgtgggaga ccacgatgga cccgtcggtg cgggtgctgc gccagatcac gctcgacgat      1920
     gcggccgctg ccgacgaact gttctcgatc ctgatgggcg aggacgtcga ggcgcgccgc      1980
     agcttcatca cccgaaacgc caaagacgtt cgcttccttg acgtttag                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page