(data stored in ACNUC30630 zone)

EMBL: CP000580.PE611

CP000580.PE611       Location/Qualifiers
FT   CDS_pept        complement(668156..669631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0612"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_0621 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96424"
FT                   /protein_id="ABN96424.1"
FT                   /translation="MFDTVFAGLEESALLAAIEQSAREEAQAGARKLAAIAQLVHLTVT
FT                   CDEECDGWVYDSWAAAASEIGAVLNIGHKRASGQMRIAVALRDRLPKVAALYLQGRLSA
FT                   RLISEISWRTRLVDDEQVLGLLDAALAEAALRWGPLSEARLARALDAVIHRYDRDAVIR
FT                   AKDTVKTRDFHIGSVDDPDELVLVWGQLLGCDAAALSARIAALLKGICDNDPRSVGERR
FT                   SCAVGAIVQGHDHLPCRCGSPACAAAAPEKSNVVISVIADPAAIEAAQKLIAAEDEHHA
FT                   AKDEPEPAACPQDSGVALLPGVKLLPIVALAEAIRGGAAIKPLWLPGPDPEPHYRPSAT
FT                   LAAFVRARDLFCRFPGCDVPAERCDIDHVVPWPYGPTHASNLNCKCRTHHLGKTFWDGW
FT                   HDEQSPDGTVTWTTPTGKRHTTVPGSRLFFPEWDTTTAELPPLAQPPPDPGRTAKMPKR
FT                   RRTRAADNAARVKAEREHNAAQRNSRAERPPPF"
     atgttcgata cggtgtttgc ggggctggag gagtccgcgc ttcttgctgc gatcgagcag        60
     tccgcgcgtg aggaggcgca ggccggggcg cggaagttgg ccgcgatcgc acagctggtg       120
     catctgacgg tgacctgcga cgaggagtgc gacggatggg tgtatgactc gtgggctgcg       180
     gccgcctccg agatcggggc ggtgttgaac atcggccaca agcgggcgtc ggggcagatg       240
     cggatcgcgg tcgccctgcg tgaccggctg cccaaggtcg cggcgctgta cctgcagggg       300
     cggttgagtg cccggttgat ctccgagatc agctggcgca cccgcctggt cgacgacgag       360
     caggtgctgg ggctgttgga tgcggcgctg gccgaggcgg cgttgcggtg ggggccgttg       420
     tcggaggcgc ggttggcccg ggccctcgat gcggtgatcc accggtatga ccgggatgcg       480
     gtgatccgag ccaaagacac cgtcaagacc cgcgacttcc atatcggatc cgttgatgat       540
     cccgacgagt tggtgttggt ctggggtcag ctgctgggct gtgacgccgc agcgctgtcg       600
     gcgcggatcg ccgcgttgct caaagggatc tgcgacaacg acccgcgcag cgtgggtgag       660
     cggcgctcgt gtgcggtggg cgccatcgtc cagggccacg accatctgcc gtgccgctgc       720
     ggctcccccg catgcgcggc agcagcgccg gagaagtcga atgtggtcat ctcggtgatc       780
     gccgatccgg ccgcaatcga ggcggcccag aagctgatcg ccgccgaaga cgaacaccac       840
     gccgcgaagg acgagcccga acccgccgcg tgcccgcagg attcgggggt ggcgttgctg       900
     cccggggtga agctcctgcc gatcgtggcg ttggccgagg cgatccgcgg tggagcggcg       960
     atcaaaccgt tgtggctgcc cggcccggat cccgaaccgc actaccggcc ctcggccacg      1020
     ctggccgcgt tcgtgcgcgc ccgcgacctg ttctgccgct tccccggctg cgacgtgccc      1080
     gccgagcgct gcgatatcga ccatgtcgtg ccgtggccgt acggacccac ccacgcgtcg      1140
     aacctgaact gcaaatgccg cacccaccac ctgggaaaga ccttctggga cggctggcat      1200
     gacgaacaat cacctgacgg cacggtgacc tggacaacgc cgaccggcaa gcgccacacc      1260
     acggtgccgg gcagccggct gttcttcccc gaatgggaca ccaccaccgc cgagttaccg      1320
     ccgctggccc aaccgccccc ggaccccggg cgcaccgcga agatgcccaa gcgacgacgc      1380
     acccgcgccg ccgacaacgc cgcccgcgtc aaagccgaac gcgaacacaa cgccgcccaa      1440
     cgaaattcgc gcgcggagcg accaccaccg ttctga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page