(data stored in ACNUC30630 zone)

EMBL: CP000580.PE612

CP000580.PE612       Location/Qualifiers
FT   CDS_pept        670176..671735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0614"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_4037 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96425"
FT                   /protein_id="ABN96425.1"
FT                   /translation="MSFSEDCVRFGDRLARLVDAGVPVKEAAVATGVSRDRCYAILRAI
FT                   GRPVGQARGRGERADQRGVADLGVVVAVFKDTGSILQAATACGVSHSTARKLLVAEGLV
FT                   TSGKIPWGKPEAKRRCLELFEQGWSTGAAAREVGVNVRTARDWRKGIRHTNNTRVHPDG
FT                   RVVDYTDRTVYKQSVSNLICDDTGRPAIDDRYLSVQDRVAIADGLLGKESLRTIAGRIG
FT                   KNVSTVSREIRARSIDGRYLPYHADRAAASARARPKQSKLVVNVVLRGAVEEGLSRKLS
FT                   PEQISNRLRRDHPDDESMQVSHETIYQALYFQARGGLKKEVQQALRTGRTRRKPHRKEG
FT                   ERYQRFTDPMVMISDRPAEVDDRAVPGHWEGDLITGEKNQTAIGTLVERSTRYTMLVHL
FT                   PGGHDAESVRDALIATISTLPAHLRGSLTWDQGCEMAGHKQFTMATDMAVYFCDPASPW
FT                   QRGSNENTNGLLRQYFPKGTDLSIYGPENLEHVAQELNGRPRKTLGWDTPAERLRDLLL
FT                   TN"
     gtgtcgtttt cggaggactg tgtccggttt ggggatcggc tagcgcggtt ggttgatgcc        60
     ggggtgccgg tgaaggaggc ggcggtcgct actggggttt cgcgtgaccg gtgttatgcg       120
     attctgcggg cgatcggccg gcctgtcggg caggcccgtg gtcggggtga gcgcgctgat       180
     cagcgtgggg tggccgacct gggtgtggtc gtggccgtat tcaaggacac cggttcgatc       240
     ctgcaggcgg ccacagcgtg tggggtgtcg cattcgacgg cacgcaaact gttggtcgcc       300
     gaggggctgg tgaccagcgg gaagatcccg tggggcaagc ccgaggcgaa acgtcggtgc       360
     ttggagctgt tcgagcaggg ttggtccacc ggggcagcgg cgcgggaggt cggtgtcaac       420
     gtgcggaccg cgcgggactg gcgcaagggg atccggcaca ccaacaacac gcgggttcac       480
     cccgatggtc gggtcgtgga ctacaccgac cggaccgtct acaaacagtc ggtgagcaac       540
     ctgatctgcg atgacaccgg acggccggcc atcgatgacc ggtatctgtc ggtccaggac       600
     cgagtggcga tcgccgatgg cctcctcggg aaggagtcgt tacggacgat cgccgggcgg       660
     atcggcaaaa acgtttccac ggtgtcgcgg gagattcgtg cgcgcagcat tgatggccgc       720
     tatctgccgt atcacgccga tcgggcggct gcctcggccc gggctcggcc caagcagtcc       780
     aaactggtgg tcaacgtggt cctgcgggga gcggttgaag aaggcctgtc gcgcaagctg       840
     tcaccggagc agatctccaa tcgcctccgt cgggatcatc ccgacgacga gagcatgcag       900
     gtgagccacg aaacgatcta ccaagccctc tacttccagg cgcgcggtgg cctcaaaaag       960
     gaagtgcagc aagcacttcg aaccgggcgc acccgacgca aaccacaccg caaagaaggc      1020
     gagcgctatc agcgcttcac cgacccgatg gtgatgatca gcgaccgccc agccgaggtg      1080
     gacgaccgtg cggttcccgg gcattgggaa ggggatttga tcaccgggga gaagaaccag      1140
     accgcgatcg gcactctggt cgagcgatcg acgcgctaca ccatgctggt gcacctgcca      1200
     ggcgggcacg acgccgaatc ggtacgggat gcgctaattg cgactatcag cactcttccg      1260
     gcgcatctgc gtggctcact gacttgggac caaggctgcg agatggcagg gcacaagcag      1320
     ttcacgatgg ccaccgatat ggccgtgtac ttctgcgatc cggccagtcc ctggcagcgc      1380
     ggcagcaacg agaacaccaa cggcctgctg cgccagtact tccccaaagg caccgacctg      1440
     agcatctacg gacccgagaa cctcgaacac gtcgcccaag aactcaacgg ccgcccacgc      1500
     aaaacgctcg gctgggatac cccagccgag cgcctgcgtg atctactact gaccaattaa      1560
//

If you have problems or comments...

PBIL Back to PBIL home page