(data stored in ACNUC30630 zone)

EMBL: CP000580.PE619

CP000580.PE619       Location/Qualifiers
FT   CDS_pept        680447..680941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0621"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   mmc:Mmcs_0628 protein of unknown function DUF779"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96432"
FT                   /protein_id="ABN96432.1"
FT                   /translation="MTPPRALITQAAADLLTRLQGRHGALMFHQSGGCCDGSSPMCYPD
FT                   GDFIVGDRDVLLAVLDVGADGVPVWISGPQFDTWKHTQLVIDVVPGRGGGFSLEAPEGM
FT                   RFLSRARAFTDAENAELAQDPPVTGARYADGDRPAGRAPVVARAEDACPIPGRRAARVQ
FT                   G"
     atgacaccgc ctcgggcgct gatcacccag gcggccgccg acctgctcac caggctgcag        60
     ggccgccacg gcgcgctgat gttccaccag tccggcggct gctgcgacgg gtcgtcgccg       120
     atgtgttatc ccgacggcga tttcatcgtc ggcgaccgcg acgtgctgct cgccgtgctc       180
     gatgtcggag ccgacggtgt gccggtctgg atctccggcc cgcagttcga cacctggaaa       240
     cacacccagc tcgtcatcga cgtggtgccc ggccgcggcg gcgggttcag cctcgaagcg       300
     cccgagggca tgcgttttct cagccgcgcc cgcgcgttca ccgacgccga gaacgccgag       360
     ttggcccagg atccgccggt gaccggcgcc cgctacgccg acggggaccg cccggccggt       420
     cgcgcacccg tcgtcgctcg agccgaagac gcgtgcccga tacctgggag gcgcgccgcg       480
     cgcgtgcagg gttga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page