(data stored in ACNUC30630 zone)

EMBL: CP000580.PE633

CP000580.PE633       Location/Qualifiers
FT   CDS_pept        692999..693484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0635"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   mmc:Mmcs_0642 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96446"
FT                   /protein_id="ABN96446.1"
FT                   /translation="MSQDENLAAVVTNAAQDIGSFIRSQREAAQVSVRQLAEKAGVSNP
FT                   YLSQIERGLRKPSADVLNQIAKALRVSAEVLYVRAGILEPSEAGQVRDAILSDTAITER
FT                   QKQVLLDIYTSFCQQNEVAGSEVDEEPTTAHTPISGDPIQRALETTPEDSRKDIHHG"
     atgtcgcagg acgagaatct tgccgccgtg gtgaccaacg ccgctcagga catcggcagc        60
     ttcatccgga gccagcgaga agcggcgcag gtgtccgtgc ggcagctggc ggagaaggcc       120
     ggtgtcagca atccctatct cagccagatc gagcggggat tgcggaaacc gtccgccgat       180
     gtgctcaacc agatcgccaa ggcgttgcgg gtctcggccg aagtgctcta cgtgcgagcc       240
     gggatcctcg aacccagcga ggccggacag gtccgcgacg ccatcctcag cgacacggcg       300
     atcaccgagc ggcagaagca ggtgctgctc gacatctaca cgtcgttctg ccagcagaac       360
     gaggtagccg gaagcgaagt agacgaggag ccgacgactg cacacacacc gatcagtggc       420
     gacccgatcc aacgcgcact agaaaccaca cccgaagatt cccgaaagga catccaccat       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page