(data stored in ACNUC30630 zone)

EMBL: CP000580.PE634

CP000580.PE634       Location/Qualifiers
FT   CDS_pept        693477..694088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0636"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96447"
FT                   /protein_id="ABN96447.1"
FT                   /translation="MAEKNPQVDIEDLKAPLLAAVGAADLALATVNEIVASLRDRAEEA
FT                   RTDANSRVEESRARINKLQEELPTQVTELRERLTADELRRAAEGYAEAAQSTYAKLVER
FT                   GEAALERLRSQPGFTDAANRVETYTDQAVELTEQALGNVATQTRAVGERAAKLVGVELP
FT                   KKTEETAEPVKAAAKKAPAKKAPAKKAPAKKAPAKKVTQK"
     atggctgaga agaaccccca ggtcgacatc gaagacctca aggccccgct gctcgccgcc        60
     gtcggcgccg ccgatctggc gctggccacc gtcaacgaga tcgtcgcgag cctgcgtgac       120
     cgcgccgaag aggcccgcac cgacgcgaac agccgcgtcg aggagagccg ggcccgcatc       180
     aacaaactgc aggaagagct tccgacgcag gtcaccgagc tgcgggagcg gctgaccgcc       240
     gacgagctgc gccgtgccgc cgagggctac gccgaggccg cgcagagcac ctacgccaag       300
     ctcgtcgagc gtggcgaggc cgcactcgag cggctgcgca gccagcccgg cttcaccgac       360
     gccgccaacc gggtcgagac ctacaccgac caggccgtcg agctgaccga gcaggcgctg       420
     ggcaacgtgg cgacgcagac ccgcgccgtc ggtgagcgcg ccgccaagct cgtcggtgtc       480
     gaactgccga agaagaccga ggagaccgcc gagccggtca aggcggcggc caagaaggcc       540
     ccggccaaga aggctccagc gaagaaggct ccggccaaga aggctccggc caagaaggtc       600
     acccagaagt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page