(data stored in ACNUC30630 zone)

EMBL: CP000580.PE652

CP000580.PE652       Location/Qualifiers
FT   CDS_pept        709285..709971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0654"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0661 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96465"
FT                   /protein_id="ABN96465.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFETTVVADGPSALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGTDVDDPGVPDGVLEAGPVRMDVERHVVSVNGQSITLPLKEFDLL
FT                   EYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGL
FT                   GYKLEG"
     atgaccagtg tgttgatcgt ggaggacgag gagtccttgg ccgatcccct ggccttcctg        60
     ctgcgcaaag agggcttcga gaccaccgtg gtggccgacg gaccctcggc gctggccgag       120
     ttcgaccgcg ccggcgccga catcgtgctg ctggacctga tgctgcccgg aatgagcggc       180
     accgacgtct gcaagcaact gcgcgcccgg tccagcgtgc cggtcatcat ggtgaccgcc       240
     cgcgacagcg agatcgacaa ggtcgtcggg ctcgaactcg gcgccgacga ctatgtcacc       300
     aaaccgtatt cggcccgcga actgatcgcg cggatccggg cggtgctgcg ccgcggcacc       360
     gacgtcgacg accccggcgt ccccgacggg gtgcttgagg ccggacccgt gcggatggac       420
     gtcgagcgcc acgtggtcag cgtcaacggc cagtcgatca cgttgccgct caaggagttc       480
     gacctcctcg agtacctgat gcgcaacagc ggccgggtgc tgacgcgcgg tcagctcatc       540
     gaccgggtgt ggggtgcgga ctacgtcggt gacaccaaga ccctcgacgt ccacgtcaag       600
     cggctgcggt cgaagatcga ggcggatccg gcgaacccgg tgcacctggt cacggtgcgc       660
     ggtctgggat acaagctcga gggctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page