(data stored in ACNUC30630 zone)

EMBL: CP000580.PE654

CP000580.PE654       Location/Qualifiers
FT   CDS_pept        complement(710292..711065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0656"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96467"
FT                   /protein_id="ABN96467.1"
FT                   /translation="MPAHPGEVELDFAREWVEFYDPDNPEHLIAADMTWLLSRWTCVFG
FT                   TPACQGTVEGRPDDGCCSHGAFLSDDDDRARLDAAVEQLTADDWQFRDKGLGKKGYLEM
FT                   DEYDDKPNLRTRKYKGACIFLNRPGFAGGIGCALHTKALKLGVEPLTMKPDVCWQLPIR
FT                   RTQDWVTRPDGSEILKTTITEYDRRGWGEGGADLHWYCTGDPAAHVGARQVYESYGPEL
FT                   TELLGEKAYAELAAMCRRRSGLGLVAVHPATRAAQ"
     atgccagccc atcccggtga ggtggagctc gatttcgccc gcgagtgggt cgagttctac        60
     gacccggaca atccagagca cctgatcgcc gcggatatga cgtggctgct gtcgaggtgg       120
     acgtgtgtct tcggcacccc ggcctgccag gggaccgtcg agggccggcc cgacgacggc       180
     tgctgttcgc acggggcctt cctgtccgac gacgacgacc gcgcccgcct cgatgcggcc       240
     gtcgaacagc tgaccgccga cgactggcag ttccgcgaca agggcctggg caagaagggc       300
     tacctcgaga tggacgagta cgacgacaag cccaacctgc ggacgcggaa gtacaagggc       360
     gcgtgcatct ttctcaaccg ccccggcttc gcgggcggga tcggctgcgc gctgcacacc       420
     aaggcgctga agctgggcgt cgaaccgctg acgatgaaac cggatgtgtg ctggcagttg       480
     ccgatccggc ggacgcagga ctgggtgacc cggccggacg gttcggagat cctcaagacc       540
     acgatcaccg aatacgaccg ccggggctgg ggtgagggtg gtgccgatct gcactggtac       600
     tgcaccggcg acccggcggc ccacgtgggc gcgcggcagg tgtacgagtc ctacggaccc       660
     gagctgaccg aactgctcgg cgagaaggcg tacgcggaac tggcggccat gtgccgtcgg       720
     cgcagcgggc tcggactcgt cgcggtccac ccggcgacgc gggccgcaca gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page