(data stored in ACNUC30630 zone)

EMBL: CP000580.PE656

CP000580.PE656       Location/Qualifiers
FT   CDS_pept        712239..713213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0658"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96469"
FT                   /protein_id="ABN96469.1"
FT                   /translation="MTEPDNSSSSTRPISVAELLAKNGTIGAPPVGGRRRRRRGNADAV
FT                   TVAELTGEIPIVTDRASDTREERADETARIPVNGATQEQETVTEPAPEDVVEPEVTEVA
FT                   EFETEELDDVDVDEDIPLEQDTVEQDTVGAEDMSPDPLLDDDEEPADLLDSDLDEPARE
FT                   RSETDDDELPSYLRSSAGPLFGGGTVADDLARRGKDADTATIDEHDDEDELDEHDLRDD
FT                   TRDDLRDDDVEAGGRMSAFLRGAWIVGQCIIAVAFGAGLFIAFDQLWKWNNIVALVLSV
FT                   LVILGLVVGVRVVRKTEDIGSTLIAVAVGALVTLGPLALLQSG"
     atgacagaac cagataacag ctccagcagc acccggccga tctcggtcgc cgagttgctc        60
     gcgaagaacg gcaccatcgg cgcgcccccg gtcggcggcc ggcgtcggcg ccgccgcggc       120
     aacgccgatg cggtgaccgt cgccgagctg accggtgaga tcccgatcgt caccgaccgc       180
     gcctcggaca cccgcgagga gcgggccgac gagaccgcgc ggatccccgt caacggcgcc       240
     acccaagagc aggagacggt caccgaaccc gcgccggagg acgtcgtcga acccgaggtc       300
     accgaggtgg ccgaattcga gaccgaggaa ctcgacgacg tcgacgtcga cgaggacatc       360
     ccgctcgaac aggacaccgt cgaacaggac accgtcggcg ccgaggacat gagtcccgac       420
     ccgctcctcg acgacgacga ggagccggcg gatctgctcg actcggacct cgacgaaccg       480
     gcgcgcgaac gttccgagac cgacgacgac gagttgccgt cgtatctgcg ttcgtcggcc       540
     gggccgctgt tcggcggcgg caccgtcgcc gacgacctcg cccgccgcgg caaggacgcc       600
     gacaccgcca cgatcgacga gcacgacgac gaggacgaac tcgacgagca cgacctccgc       660
     gacgacacgc gcgatgacct ccgcgatgat gacgtcgagg ccggcggtcg catgtcggcg       720
     ttcctgcgcg gcgcctggat cgtcggacag tgcatcatcg ccgtcgcgtt cggagcgggc       780
     ctgttcatcg cgttcgacca gctgtggaag tggaacaaca tcgtcgcgct cgtgctgtcg       840
     gtgctggtga tcctcgggct ggtggtcggg gtgcgcgtgg tgcgcaagac cgaggacatc       900
     ggcagcacgc tgatcgccgt ggcagtgggc gcactggtca cgctgggacc gctggcgttg       960
     ctccagtccg gctag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page