(data stored in ACNUC30630 zone)

EMBL: CP000580.PE659

CP000580.PE659       Location/Qualifiers
FT   CDS_pept        714986..715870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0661"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: mmc:Mmcs_0668 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding; Ketopantoate
FT                   reductase ApbA/PanE, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96472"
FT                   /protein_id="ABN96472.1"
FT                   /translation="MLWRMARIAIIGGGSMGEALLSGLLRAGRQVKDLVVAEKHPDRAK
FT                   FLAEKHSVLVTSVVEAIDNAHYVIVAVKPADVEHVIDDIAEAAANADTDTAEQVFVTVA
FT                   AGVSTAYYENKLPAGAPVIRAMPNAPVVVGGGVSALAPGRFATPEHLKEVSAIFDSVGG
FT                   VLTVPESQLDAVTAVSGSGPAYFFLMVEALVDAAVASGLSRTVATDLVVQTMAGSAAML
FT                   LERLDEAQPVGDAAMGTAMDTTAAQLRATVTSPAGTTAAGLRELERGGLRSAVANAVEA
FT                   AKTRSEQLGITSE"
     atgctttggc gcatggccag aatcgcgatc atcggtggcg gaagtatggg tgaggcgctg        60
     ctgtccgggc tgctccgggc cggcaggcag gtcaaggatc tggtggtcgc cgagaagcat       120
     ccggaccgcg cgaagttcct cgccgagaag cactcggtgc tggtgacctc cgtcgtcgag       180
     gccatcgaca acgcccacta cgtcatcgtc gcggtgaagc cggccgacgt cgagcacgtc       240
     atcgacgaca tcgccgaggc cgccgccaac gccgataccg acaccgccga gcaggtcttc       300
     gtcacggtcg cggccggggt gtcgaccgcg tactacgaga acaagctgcc ggcgggcgca       360
     ccggtgatcc gcgcgatgcc caatgcgccg gtcgtggtcg gcgggggagt cagcgcgctg       420
     gcgccgggcc gcttcgcgac ccccgagcac ctcaaggagg tctcggcgat cttcgactcg       480
     gtcggcggcg tgctgaccgt gccggagtcg cagctggacg cggtgaccgc ggtgtcgggc       540
     tccgggcccg cctacttctt cctgatggtc gaggcgttgg tcgacgccgc ggtggccagt       600
     gggctgtcgc gcacggtggc caccgacctg gtggtgcaga cgatggcggg ttcggccgcg       660
     atgttgctgg agcgcctcga cgaggcccag ccggtgggcg atgcggcaat gggaacggcg       720
     atggacacca cggcggcgca actccgcgct acggttacct caccggccgg taccaccgcc       780
     gctgggctgc gagaactcga acgcggtggt ttgcggtcgg cggtggcgaa tgcggtggaa       840
     gccgcgaaaa cccgctctga gcagctagga attacatcag agtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page