(data stored in ACNUC30630 zone)

EMBL: CP000580.PE66

CP000580.PE66        Location/Qualifiers
FT   CDS_pept        complement(71010..72614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95879"
FT                   /protein_id="ABN95879.1"
FT                   /translation="MAGDEVRVEPADLRARATTLDEEITDESQRPTPPCGLPFVTASAA
FT                   GIAAGSDTLRSHLISGNREAERLAAVLSEAADVYQQIDNRAAQALEYPDGPRSVEPVPV
FT                   NPTLPPSVPPIEFPATVPAVPGGQTDAGFMDVKAAAQIIHSGDSGPMRTYGEQAKKFAG
FT                   TLRDRAASFNLDGINWDGTAAEKAGDAVRQHKEWLEKLAESYEFLGTEAIDMADAHDKW
FT                   SGQHPTVAEVEAVEARVAQAGQAGDKDALARAMMDYLALQRKSEDVRTSYSADVAGKSL
FT                   PKVLDPPPGAAPVPPISSNGDPRKGKTQPAGEGAPGEPGSGGGGAQPGGRPGGQPGGQA
FT                   AAAPMGGGSPAGQGGAQPAGASSGGGGSPSGGGGSPAGGGGAPAAPAAGGGLPGGLPGG
FT                   GPDGLPPLDDPALKPAAASGGGAGGGSGGGAGGGGGGVPPSPLQPAVGAETVAPGAAGT
FT                   GRAGAAAAGPAGAMGAMGGMGGMPMGGHGAGRGQGGGEKKRTPGLAPDEDLYVEDRPFT
FT                   ESVIGYTPKPRDRKDSK"
     atggcggggg atgaagtccg agtcgaacct gcggatctgc gggctcgagc caccaccctg        60
     gacgaggaga tcaccgacga gtcgcagcgg cccacaccgc cgtgcggcct cccgttcgtc       120
     acggcgtcgg cggccggcat cgcggccggt tcggacacgc tgcgcagcca cctgatctcc       180
     ggcaaccgcg aagccgaacg gctcgccgcg gtgctgtccg aggcggccga cgtctaccag       240
     cagatcgaca accgcgcggc ccaggcgctg gagtaccccg acggaccacg ctcggtggaa       300
     ccggtccccg tcaaccccac actgccgccg tcggtcccgc cgatcgaatt ccccgccacg       360
     gtgcccgcgg tcccgggcgg ccagaccgac gccggcttca tggatgtgaa ggccgccgcg       420
     cagatcatcc actccggcga ctcgggcccg atgcggacct acggggaaca ggcgaagaag       480
     ttcgccggga cgctgcgcga cagggccgca tccttcaacc tcgacggcat caactgggac       540
     ggcaccgccg ccgagaaggc cggcgacgcg gtccgtcagc acaaggagtg gctggagaag       600
     ctggccgaga gttacgaatt cctcggcacc gaggcgatcg acatggccga tgcgcacgac       660
     aagtggtcgg gtcagcaccc gaccgttgcg gaggtcgagg cggtcgaggc cagggtggcg       720
     caggccggtc aggcgggcga caaggacgcg ctcgccaggg ccatgatgga ttaccttgcg       780
     ctgcagcgga agtccgaaga cgtccggacc agctacagcg ccgacgtcgc cggtaagagc       840
     ctgcccaagg tgctcgaccc gccaccggga gcagcgccgg taccgccgat cagcagcaac       900
     ggcgatccgc ggaaggggaa gacccagccc gccggcgagg gtgcacctgg tgaacccggc       960
     tccggcgggg gcggcgccca acccggcggc cggcccggtg ggcagcccgg cggtcaggcc      1020
     gcggcggcgc cgatgggcgg ggggtctccc gccggacagg gcggcgctca gcccgcgggc      1080
     gcctcatccg gcggcggcgg ttcaccgtcg ggaggcggcg gctctcccgc cggtggcggt      1140
     ggcgccccgg ccgcaccggc tgccggtggt ggcctaccgg gcggcctgcc cggtggcggc      1200
     ccggacgggc tgcctccgct ggacgacccc gcgctgaagc cggccgccgc gagcggtggc      1260
     ggcgccggtg gtggctcggg tggtggagcc ggcggcggtg gcggcggggt cccaccctcc      1320
     ccgctgcagc ccgctgtcgg agccgagacc gtcgcccccg gggcggccgg gacggggcgc      1380
     gccggtgccg ccgcggccgg cccggccggt gccatgggtg cgatgggggg tatgggcggt      1440
     atgccgatgg gtggccacgg cgcgggccgc ggtcagggtg gcggcgagaa gaagcgcacg      1500
     cccggcctgg caccggacga ggatctctac gtcgaggacc gtccgttcac cgaatccgtc      1560
     atcggctaca cgcccaagcc gcgggatcgg aaggactcga agtga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page