(data stored in ACNUC30630 zone)

EMBL: CP000580.PE676

CP000580.PE676       Location/Qualifiers
FT   CDS_pept        727640..728551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96489"
FT                   /protein_id="ABN96489.1"
FT                   /translation="MLVTEPLVQSSESVTLLHMTELAENRTEIDALPLGPQSLVWRYFG
FT                   DNRMYLIGPRPAVLQNMLAELGQGVLDHSVFFSDTAARVKRSLPPIFMTVYGSDDRNEG
FT                   FNVRDFHHDIKGEMPDGSRYHALDPETYFWAHATFVEQVLYFADTFVKRLTRAEKEQIY
FT                   LESKTWYRRYGVSDRPMPATYAEFEQYWERMLDETVIAHQTARYGVGYVTKGFPCPKGV
FT                   HPTVWRVLSIVFDPLAAFLTTGGLPPQARRLLDLPWSEHQERRYQRFAAFWRSRPVNWV
FT                   WDRLPMSVRYNKYAQRGYAQAG"
     atgctggtca ctgaaccgtt ggtacaaagt tcggaatctg taacactgtt gcacatgacg        60
     gagttggcgg agaacaggac cgagatcgac gcactaccac tggggccgca atcgctggtc       120
     tggcgctact tcggcgacaa ccgcatgtac ctgatcggcc cgcggcccgc ggtcctgcag       180
     aacatgctcg ccgaactcgg ccagggcgtc ctggaccact cggtgttctt ctccgacacc       240
     gccgcgcgcg tcaaacggtc gctaccgccg atcttcatga cggtctacgg atcagacgac       300
     cggaacgagg gcttcaacgt ccgcgacttc caccacgaca tcaagggcga gatgcccgac       360
     ggttcgcgct accacgcgct ggatccggag acctacttct gggcgcacgc gacgttcgtc       420
     gagcaggtcc tctacttcgc cgacaccttc gtcaagcgcc tgacgcgtgc ggagaaggag       480
     cagatctacc tggagtcgaa gacctggtac cgccgctacg gcgtcagcga ccggccgatg       540
     cccgcgacgt acgccgagtt cgagcagtac tgggagcgga tgctcgacga gaccgtcatc       600
     gcgcaccaga ccgccagata cggtgtcggc tacgtgacca agggctttcc gtgccccaag       660
     ggtgtgcacc ccacggtgtg gcgggtgctg tcgatcgtct tcgatccgct cgcggcgttc       720
     ctcaccaccg gtgggctgcc gccccaggcc cggcgcctgc tcgacctgcc gtggagtgaa       780
     caccaggaac ggcgctacca gcgcttcgcg gcgttctggc ggtcccggcc ggtcaactgg       840
     gtgtgggacc ggctgccgat gagcgtccgc tacaacaagt acgcccaacg cggctatgca       900
     caagccggat ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page