(data stored in ACNUC30630 zone)

EMBL: CP000580.PE680

CP000580.PE680       Location/Qualifiers
FT   CDS_pept        730137..730520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96493"
FT                   /protein_id="ABN96493.1"
FT                   /translation="MAYLEPPWFTRVVFNRIAKVTGVGGAETLTVSRRRTGGLQSVPVI
FT                   PVEVSGHRYVVSTRGEAQWVKNLRASGTATIGSTAYVAREVAESERPVVLAAYREKAGR
FT                   AVAGYFRRLPGDADHPVFALVPK"
     atggcgtacc tcgagccgcc gtggttcacc cgcgtggtct tcaaccggat cgcgaaggtc        60
     accggtgtgg gcggggccga aacactgacc gtcagccgtc gccgcactgg cgggctgcag       120
     agtgttccgg tcatccccgt cgaggtgagc ggtcacaggt acgtggtgtc gacgcgcggc       180
     gaggcgcagt gggtgaagaa cctgcgggca tccgggaccg cgacgatcgg ttcgacggca       240
     tacgtcgcgc gcgaggtcgc cgagtccgaa cgccccgtcg tcctcgccgc ctaccgggag       300
     aaagcgggac gtgccgtcgc ggggtacttc cgccggctgc cgggcgacgc cgaccatccg       360
     gtgttcgcgc tcgtgccgaa atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page