(data stored in ACNUC30630 zone)

EMBL: CP000580.PE684

CP000580.PE684       Location/Qualifiers
FT   CDS_pept        733112..733891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0686"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: mmc:Mmcs_0693 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96497"
FT                   /protein_id="ABN96497.1"
FT                   /translation="MTGFAEIAAAGPVALAMGLCVLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDTDETGSGAVAVRTRRLKVAGAAGLFVAGFTAVFLLGTVAVLGMTTTLITNQLL
FT                   LQRIGGVVTIIMGLVFIGLIPALQRQARFTPRQLSTVAGAPLLGAVFALGWTPCLGPTL
FT                   TGVITVASATDGASVARGVALVIAYCLGLGIPFVLLAFGSARAVQGLGWLRRHTRTIQI
FT                   FGGVLLLIVGAALVTGVWNDFVAWVRDGFVSDVRLPI"
     gtgaccggat tcgccgagat cgccgcggcc ggcccggtgg ccctggcgat ggggctctgc        60
     gtgctggccg ggctggtgtc gttcgcctcg ccgtgcgtgg tgccgctggt gccgggctac       120
     ctgtcctatc tggccgcggt ggtgggcgtc gacaccgacg agaccggctc cggcgccgtc       180
     gccgtgcgca cccggcggct caaggtggcc ggcgccgccg ggctgttcgt cgccgggttc       240
     accgcggtgt tcctgctcgg caccgtcgcg gtgctcggca tgacgacgac gctgatcacg       300
     aatcagcttc tgctgcaacg catcggcgga gtcgtcacga tcatcatggg tctggtgttc       360
     atcgggttga tccccgcgct gcagcggcag gcccggttca cccctcgtca gctgtccacc       420
     gtcgccggtg cgccgctact gggcgcggtg ttcgcactcg gctggacgcc gtgcctggga       480
     cccacgctga ccggggtcat cacggtcgcg tcggcgaccg acggcgccag cgtcgcccgc       540
     ggcgtcgcgc tggtcatcgc ctactgcctg ggcctcggca tcccgttcgt gctgctggca       600
     ttcggttcgg cgcgcgcggt gcaggggctg ggctggctgc gccggcacac ccgcaccatc       660
     cagatcttcg ggggagtgct gctgctgatc gtgggcgccg cactggtcac cggggtgtgg       720
     aacgacttcg tggcgtgggt gcgcgacggt ttcgtcagcg acgtcaggtt gccgatctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page