(data stored in ACNUC30630 zone)

EMBL: CP000580.PE700

CP000580.PE700       Location/Qualifiers
FT   CDS_pept        complement(746756..747790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0702"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mmc:Mmcs_0708 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96513"
FT                   /protein_id="ABN96513.1"
FT                   /translation="MPSTDLWEIGAWALACSIPVVLAGALVIRLARTWSLAVSMVVLVL
FT                   IPVIATFTGVLGASGFMITETFEPIAVVLVVVAVVTIPGAVMLGRYQARRTVWEQEIRD
FT                   SERAAEMSRRQLVAFVSHDLRTPLAGIRAVSEAIADGLVGGDEVRAHAKHIEQESIRLS
FT                   EMVDDLFEMSKINAGAVQPTFDRVALDEVVDDVLAAHRIAAERAGVQLRAELPDEPVRV
FT                   LGSDRALVRVLSNLVANAIAHTPEGGRVQLALGSDENVAWARVDDTGVGIDEADLPRVF
FT                   DVAYRGSNDRVPREDSSLPSGSGLGLAIAAGLVQAHRGTLSAHNLDTGARFEVRLPLAS
FT                   DVSD"
     gtgccgtcaa ctgacctctg ggagatcggc gcctgggcgc tggcctgctc gattccggtg        60
     gtgctggccg gtgcgctcgt catccggctg gcccgcacgt ggtcgctggc ggtcagcatg       120
     gtcgtgctgg tgctgattcc cgtgatcgcg accttcaccg gcgtgctggg cgccagcgga       180
     ttcatgatca ccgagacctt cgaaccgatc gccgtcgtgc tcgtggtcgt ggcggtggtc       240
     accatccccg gggccgtgat gctcggccgc taccaggccc gccgcacggt gtgggaacag       300
     gagatccgcg actccgaacg ggcggccgag atgtcgcgac gccagctggt cgcgttcgtc       360
     agccacgatc tgcggacccc gctggccggg atccgggcgg tgtccgaagc catcgccgac       420
     ggtctggtcg gcggcgacga ggtgcgggcc cacgccaagc acatcgaaca ggagtccatc       480
     cgcctctcgg agatggtcga cgacctgttc gagatgagca agatcaacgc cggggcggtg       540
     cagcccacct tcgaccgggt cgcgctcgac gaggtggtcg acgacgtgct ggccgcccac       600
     cgcatcgccg ccgaacgcgc gggagtgcaa ctacgggccg aactgcccga cgaacccgtg       660
     cgggtgctgg gcagcgaccg cgcgctggtg cgggtgctgt ccaatctggt ggccaacgcc       720
     atcgcgcaca ccccggaggg cgggcgcgtg cagttggcgc tcggatccga cgagaacgtg       780
     gcctgggccc gtgtcgacga caccggggtc ggcatcgacg aggccgacct gccgcgggtg       840
     ttcgacgtcg cctaccgcgg atcgaacgac cgtgtgccgc gcgaggattc gtcgttgccg       900
     agcggttcgg ggctggggct ggccatcgcc gcgggtctgg tgcaggcgca ccggggcacg       960
     ctgtcggcgc acaacctgga caccggcgcg cgcttcgagg tgcggctgcc gctggcctcg      1020
     gacgtctccg actga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page