(data stored in ACNUC30630 zone)

EMBL: CP000580.PE714

CP000580.PE714       Location/Qualifiers
FT   CDS_pept        759731..760288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0716"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96527"
FT                   /protein_id="ABN96527.1"
FT                   /translation="MWEVVVNAPLEQAKRPVSALLAGPYGHPFHPILVTVPIGAWASSL
FT                   VFDVASHLVDGPGFLAQGAEWLIAIGVLGALVAATVGFLDLIAIPSRTRAHRIGLLHMA
FT                   LNLTVTALYIAGFAWRHADYPQQAAVGFGPLALSVVSFAVLAVSGYLGGMLSYRYGVRV
FT                   AEESTQAEGFGRVEQPAQGGKP"
     atgtgggagg tggtcgtgaa cgcaccactc gagcaggcca agcgcccagt cagcgcattg        60
     ctggccggcc cctacgggca cccgttccat ccgatcctgg tcacggtgcc gatcggggcg       120
     tgggcttcca gcctggtctt cgacgtcgcg tcgcatctcg tcgacggacc gggcttcctg       180
     gcccaaggtg cggagtggct catcgcgatc ggcgtgctcg gcgccctcgt ggccgcgacg       240
     gtgggcttcc tcgacctgat cgcgatcccc tcacgcaccc gggcacaccg gatcggcctg       300
     ctgcacatgg cgctcaatct gaccgtcact gcgctctaca tcgccggctt cgcctggcga       360
     cacgcggact atccgcagca ggccgcggtg gggttcgggc cgctggcact gtcggtggtg       420
     agcttcgcgg tgctcgcggt gtcgggttac ctgggcggaa tgctgtccta ccggtacggc       480
     gtgcgggtcg ccgaggagtc aacgcaggca gagggattcg gacgagtcga acaaccggca       540
     cagggaggaa aaccatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page