(data stored in ACNUC30630 zone)

EMBL: CP000580.PE77

CP000580.PE77        Location/Qualifiers
FT   CDS_pept        85404..86039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0077"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95890"
FT                   /protein_id="ABN95890.1"
FT                   /translation="MPHTASRGPGRPPAAKAAETRERILRAAREVFSELGYDAATFQAI
FT                   AIRADLTRPAINHYFASKRVLYREVVEQTNAWVISAGMERAHGEGTLLGRLSAFFSAAM
FT                   HAESEDRSAAAFLVTSVLESQRHPDLRSDEHDALRMSRSFVSWAVNDAIERGELSTDTD
FT                   IPSIVEMLVAVMWGMGFYAGYVGGQQELEVIVEKFELLMANKLWQLNT"
     gtgccgcata ctgccagccg ggggccgggg cgaccgcccg cagcgaaggc cgcagagaca        60
     cgtgagcgca tcctgcgtgc tgctagagag gtcttcagcg aactcggtta cgacgctgcg       120
     actttccagg cgatcgcgat ccgggccgat ctgacccgcc cggcgatcaa ccattacttc       180
     gcgagcaaac gcgtcctcta ccgcgaggtg gtcgaacaga ccaatgcgtg ggtgattagc       240
     gcgggaatgg aacgcgccca cggcgaaggc acgctgctgg gccgtttgtc ggcgttcttc       300
     tcggccgcca tgcacgccga atccgaagac cgttcggccg ccgcgtttct cgtcacctcg       360
     gtcctcgaat cgcagcggca tcccgatctg cgcagcgacg agcacgacgc gttgcggatg       420
     tctcgttcgt tcgtgtcgtg ggcggtcaac gacgccatcg aacgcggtga gctcagcacc       480
     gacaccgaca tcccgtcgat cgtcgagatg ttggtcgcgg tcatgtgggg gatgggtttc       540
     tacgccggct atgtgggcgg tcagcaggag ctcgaggtca tcgtcgagaa gttcgagctg       600
     ctgatggcga acaagctctg gcagctcaac acctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page