(data stored in ACNUC30630 zone)

EMBL: CP000580.PE88

CP000580.PE88        Location/Qualifiers
FT   CDS_pept        complement(94965..96266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0088"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0098 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95901"
FT                   /protein_id="ABN95901.1"
FT                   /translation="MERRALGHRQWPGGPSAWASSYRDGMDFAMSAKALDYHQRLTDFM
FT                   VEHVFPAEADYHRYREEAGPKDHTVPPVVEDLKKLAKERGLWNLFLPSESGLSNLEYAE
FT                   LAELSGWSMEIAPEVINCAAPDTGNMETLHLFANDEQRKQWLDPLLNGEIRSAFAMTEP
FT                   AVASSDARNIETTMLRDGSDYVINGRKWWITGAADPRCKLLIVMGRTNPDAASHQQQSM
FT                   ILVPADTPGVDIQRSLPVFGWQDQHGHCEIVFDNVRVPVENLLHEEGSGFAIAQARLGP
FT                   GRIHHCMRALGAAERALALMIDRVQKRVAFGKPLAEQGVVREAIAKSRNEIDMARLLCH
FT                   KAAWTIDQEGNKAAHVLVSQIKSVAPQVACDVIDRAIQVHGGAGVSDDFPLARLYAWHR
FT                   AMRLFDGPDEVHMRTIARAELGREKSPFAAAVCR"
     atggaacgtc gggctctcgg tcaccgacag tggcccggcg gaccgtctgc gtgggcatcg        60
     tcatatcgtg acggcatgga cttcgcgatg tcggccaagg cgctcgacta ccaccagcgg       120
     ctcaccgatt tcatggtcga gcacgtcttc cccgccgagg cggactacca ccgttaccgc       180
     gaggaggccg gaccgaagga ccacacggtc ccgccggtcg tcgaggacct caagaagctg       240
     gccaaggaac gcggcctgtg gaacctattc ctgccgtcgg aatccgggtt gtccaacctg       300
     gagtacgcgg aactggccga actgtccggg tggagcatgg agatcgcccc cgaggtgatc       360
     aactgtgccg cccccgacac cggcaacatg gagaccctgc acctcttcgc caacgatgag       420
     cagcgcaagc agtggctcga cccgctgctg aacggcgaga tccgcagcgc gttcgcgatg       480
     accgaaccgg ccgtcgcctc ctccgacgcc cgcaacatcg agacgacgat gctgcgtgac       540
     ggatccgact acgtgatcaa cggccgcaag tggtggatca ccggcgcggc cgatccgcgc       600
     tgcaagctcc tcatcgtgat gggccgcacc aacccggatg cggccagcca tcagcagcag       660
     tcgatgatcc tggtgcccgc cgacaccccc ggcgtcgaca tccagcggtc gcttcccgtg       720
     ttcggctggc aggaccagca cggccactgc gagatcgtgt tcgacaacgt ccgcgtgccc       780
     gtcgagaacc tgctgcacga agagggcagc ggtttcgcga tcgcccaggc ccggctcggc       840
     ccgggccgca tccaccactg catgcgggcc ctcggtgccg ccgagcgggc gctggcgctg       900
     atgatcgacc gcgtccagaa gcgggtggcc ttcggcaagc cgctggccga acagggtgtg       960
     gtgcgcgagg cgattgccaa gtcccgcaac gagatcgaca tggcccggct gctgtgccac      1020
     aaggcggcgt ggaccatcga ccaggagggc aacaaggccg cgcacgtgct ggtgtcgcag      1080
     atcaagtcgg tggccccgca ggtcgcctgc gacgtcatcg accgcgcgat ccaggtgcac      1140
     ggtggggccg gggtgtccga cgacttcccg ctggcccggc tctacgcgtg gcaccgcgcg      1200
     atgcggctgt tcgacggccc cgacgaggtg cacatgcgga ccatcgcgcg cgccgaactg      1260
     ggccgcgaga agtccccgtt cgcagccgcg gtgtgccgct ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page