(data stored in ACNUC30630 zone)

EMBL: CP000580.PE90

CP000580.PE90        Location/Qualifiers
FT   CDS_pept        complement(97472..98911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0090"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95903"
FT                   /protein_id="ABN95903.1"
FT                   /translation="MLSLETTATAAYVVAAILFILALAGLSKHETSRAGNTFGIAGMAV
FT                   ALIATIALALDHDIEPLGLGLLIGAMVIGAVIGLWRAKVVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEGQPDGAEAAAIAAEGMLGIHSAEVVIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPMMLPGKNALNVGALVAFAALTVWFVIDPQLWLLVVVTVLALLLGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAASGFLLANDLLIVTGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIEAGPAEDKDYGEHREINAEGAAELLSSASSVIITPGYGMAVAQAQYGVADL
FT                   TRKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVI
FT                   GANDTVNPAASEDPGSPIAGMPVLTVWNANHVIVFKRSMASGYAGVQNPLFFRDNTQML
FT                   FGDAKDRVDAINAALTVPEKV"
     atgttgtcac tggaaaccac cgcgacggcg gcctacgtcg tcgcggccat cctgttcatc        60
     ctcgccctgg ccggactgtc caagcacgag acctcgaggg cgggtaacac cttcggcatc       120
     gccgggatgg ccgtcgccct gatcgcgacc atcgcgctgg ccctcgatca cgacatcgag       180
     ccgctcggcc tggggctgct gatcggcgcc atggtcatcg gcgccgtgat cggactgtgg       240
     cgcgccaagg tggtcgagat gaccggtatg cccgaactga tcgcgctgct gcactcgttc       300
     gtcggcctgg ccgccgtgct ggtcggctgg aacggctacc tgcatgtcga gggtcagccc       360
     gacggcgccg aggcggccgc gatcgccgcc gaaggcatgc tcggcatcca ctcggccgag       420
     gtcgtcatcg gtgtgttcat cggggcggtc acgttcaccg gctcgatcgt ggccaacctc       480
     aaactgtcgg cccggatcaa atccgcgccg atgatgctgc ccggtaagaa cgctctcaac       540
     gtcggggctc tcgtggcctt cgccgccctg acggtgtggt tcgtcatcga tccgcagctg       600
     tggctgctcg tcgtggtgac cgtgctggcg ctgctgctgg gctggcacct ggtcgcctcg       660
     atcggcggcg gcgacatgcc cgtggtggtg tcgatgctca acagctactc cggctgggcc       720
     gccgcggcgt cgggcttcct gctggccaac gacctgctga tcgtcaccgg cgcactggtc       780
     gggtcctcgg gcgcctacct gtcctacatc atgtgcaagg cgatgaaccg gtcgttcatc       840
     tcggtgatcg ccggaggctt cgggatcgag gccgggcccg ccgaggacaa ggattacggc       900
     gagcatcggg agatcaacgc cgagggcgcc gccgagctgc tgtcctcggc cagttcggtg       960
     atcatcacac cgggctacgg gatggccgtc gcccaggccc agtacggggt cgccgacctg      1020
     acccgcaaac tgcgcgaacg gggcgtcaac gtccggttcg gcatccatcc cgtcgccggc      1080
     cgcctgcccg gccacatgaa cgtgctgctc gccgaggcca aggtgcccta cgacatcgtg      1140
     ctcgaaatgg acgagatcaa cgacgacttc gccgacaccg acgtcgtact cgtcatcggc      1200
     gccaacgaca ccgtcaaccc cgccgcatcc gaggatccgg gcagcccgat cgccggcatg      1260
     cccgtcctca cggtgtggaa cgcgaaccac gtcatcgtgt tcaaacgctc catggcctcc      1320
     ggctacgccg gcgtgcagaa cccgctgttc ttccgcgaca acacccagat gctgttcggt      1380
     gacgccaaag accgggtcga cgccatcaac gcggcgctca cggtccccga gaaggtctag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page