(data stored in ACNUC7421 zone)

EMBL: CP000667.PE1

CP000667.PE1         Location/Qualifiers
FT   CDS_pept        625..2388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52486"
FT                   /db_xref="GOA:A4X0T6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T6"
FT                   /protein_id="ABP52486.1"
FT                   /translation="MTDTTDLAAVWTATTDELADEIVSAQQRAYLRLTRLRAIVEDTAL
FT                   VSVPDAFTRDVIESRLRPAITEALTRRLGRPIQVAVTVRAPEDAPGRPAGTIYHSAPSP
FT                   ETGALPGDTTDRAAGGGPDDGVDHRFPLIPGQAQPERRTAAPAGSYGEQTTPMSRDSQE
FT                   PLFSSAFAGPPRGERHDVDEQARLGPPVTERPFEAHYRAEGADQHGGRALPRELGTDSG
FT                   PGRVDHRPGGREDRRPPAPADGGGNRLNPKYMFETFVIGSSNRFAHAASVAVAESPAKA
FT                   YNPLFIYGSSGLGKTHLLHAIGHYATTLGNANSVRYVSTEEFTNDFINSLRDDKTSAFQ
FT                   RRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATLEDRL
FT                   RTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPDVLEFIASRVSNSIRELEGALI
FT                   RVTAFASLTRSSVELSLAEEVLRDFIPDGTGPEITADQIMVATADYFGVSLEDLRGHSR
FT                   SRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSLYNQI
FT                   AELTNRIKQNT"
     gtgacggata caaccgacct cgccgcggtg tggacggcaa cgaccgacga gttggccgac        60
     gagatcgtct ctgcccagca gcgggcctat ctgcgactga cccgcctccg cgccatcgtc       120
     gaggacaccg cgctcgtctc cgtcccggac gccttcaccc gagatgtcat cgagtcccgg       180
     ctccgcccgg cgatcaccga ggccctcacc cgccggctgg ggcgccccat ccaggtggcg       240
     gtcacggtgc gagcaccgga agacgccccc ggccgcccgg ccggcaccat ctaccacagc       300
     gccccgagcc cggagaccgg cgcgttgccc ggcgacacca ccgaccgcgc cgcgggaggg       360
     ggcccggacg acggcgtgga ccacaggttc ccgctgatcc ccgggcaggc ccaaccggag       420
     cgccgcactg cggcgcccgc tggttcgtac ggcgagcaga cgacgccgat gtcccgggac       480
     agccaggagc cgttgttcag ctccgccttc gccgggccgc cccgaggcga gcgtcacgat       540
     gttgacgagc aggcccggct gggcccaccg gtgaccgaac gcccgttcga ggcccactac       600
     cgagcagagg gggcggacca gcacgggggg cgggccctgc cccgggaact cggcaccgac       660
     agcgggccgg ggagggtgga ccaccgaccg ggtggccgcg aggaccgtcg gccaccggca       720
     cccgccgacg gcggcggcaa ccggctcaac ccgaagtaca tgttcgagac gttcgttatc       780
     ggttcgtcga accgattcgc ccacgcggct tcggtggcgg tcgccgagtc accggcgaag       840
     gcgtacaacc cgctgttcat ctacggcagc tcagggctgg gcaagacgca cttgctgcac       900
     gcgatcggcc actacgccac gacgctcggc aacgccaact cggtccggta cgtctcgacc       960
     gaggagttca ccaacgactt catcaactcg ctgcgcgacg acaagaccag cgccttccag      1020
     cgccggtacc gggacgtcga catcctcctg atcgacgaca tccagttcct ggagaaccgg      1080
     gagcggacgc aggaggagtt cttccacacc ttcaacacac tgcacaacgc caacaagcag      1140
     atcgtgatca cctccgaccg gtcgccgaag cagctggcga ctctggagga ccggctgcgg      1200
     acccggttcg aatggggcct actcgccgac atccagccgc cagacctgga gacccggatc      1260
     gcgatcctcc agaagaaagc cgcccaggaa cggctgttcg ccccgccgga cgtactggag      1320
     ttcattgcgt cccgagtgtc gaactccatc cgagaacttg agggtgcgct gatccgggtc      1380
     accgcgttcg ccagcctcac ccggtcatcg gtggagttgt cgctggccga ggaggtgctg      1440
     cgggacttca ttccggacgg caccgggcca gagatcaccg ccgaccagat catggttgcc      1500
     accgccgact acttcggggt gagtctggag gacctgcgcg ggcactcccg ctcgcgggtg      1560
     ctcgtcaacg cccgccaggt cgccatgtac ctgtgccggg agctcaccga cctgtcgctg      1620
     ccccgaatcg gacaggcgtt cgggggccgc gaccacacca cggtcatgca cgccgaccgc      1680
     aagatccgtc agcagatggc cgagcgccgg tcgctctaca accagatcgc cgagctgacc      1740
     aaccggatca agcagaacac ctga                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page