(data stored in ACNUC7421 zone)

EMBL: CP000667.PE100

CP000667.PE100       Location/Qualifiers
FT   CDS_pept        complement(105874..107712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0100"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52585"
FT                   /db_xref="GOA:A4X135"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X135"
FT                   /protein_id="ABP52585.1"
FT                   /translation="MATAPRVRAPELKGRRWLNTGGRHLDLADLRGRITVLDFWTFCCI
FT                   NCLHVLDELRPIEQKYADVLVVIGVHSPKFEHEKDPDALADAVERYGVHHPVLDDPELN
FT                   MWQQYAARAWPTLAVIDPEGYVVATMAGEGHAEGLVRLVDDLIATHEAKGTLRRGDGPY
FT                   VPPAEPETTLRFPGKSVVLDNGNLLVSDSARHSLAELAPDGETLLRRIGTGARGRADGT
FT                   ATAATFAEPQGLCLLPAQVSRLVGYDLVVADTVNHLLRGVRLATGEVVTVAGTGRQWRS
FT                   TVDDHAHDALSVDLSSPWDLAWYDDRLVIAMAGIHQLWWFDPVKRTTGMYAGSTVEARK
FT                   DGPLAEAWLAQPSGLSVSADGSRLWVADSETSAVRYVENGILTTAVGQGLFEFGHVDGP
FT                   AAQALLQHPLGVCALPDGSVLIADTYNGAVRRYDPESDSVGTVADGLAEPSDLLLTPDG
FT                   GVLVVESAAHRLTRLAPGALTAAGASTVNGPRHRTERKPTELRAGAVTLEVIFTPAPGQ
FT                   KLDDSYGPSTRLVVSASPPELLLSGAGTSTELSRELVISDSVPEGVLQVTAQAATCDAD
FT                   VAHAACHLTRQDWGVPIWVVDDAADRLPLVLRGMDA"
     atggctaccg cgcctcgcgt ccgagcaccc gagctgaagg gccgtcgctg gctgaacacc        60
     ggcggacgac acctggacct ggcggacctt cgaggccgca taaccgtcct cgacttctgg       120
     accttctgct gcatcaactg cctgcacgtg ctcgacgagc tacgtcccat cgagcagaag       180
     tacgccgacg tcctcgtggt catcggcgtc cactcgccca agttcgaaca cgagaaggac       240
     ccggacgccc tggccgacgc cgtcgagcgg tacggcgtac accacccggt gctcgacgac       300
     cccgaactga acatgtggca gcagtacgcc gcccgggcct ggccgaccct ggccgtgatc       360
     gaccccgagg ggtacgtggt ggccacgatg gccggtgagg gacatgccga gggcctggtc       420
     cggctcgtgg acgacctgat cgccacccac gaggccaagg gcaccctgcg ccggggtgac       480
     ggaccgtacg tgccgccggc cgagccggag accacgctgc gttttcccgg caagtctgtc       540
     gtactcgaca acgggaacct gctggtgtcg gactcggccc ggcactccct cgcggagctg       600
     gcccccgacg gcgagacgct gctccgccgg atcggcaccg gcgcacgcgg ccgggccgac       660
     gggacggcca cagcggccac cttcgccgag ccgcaggggc tctgcctgct accggcccag       720
     gtctcccggc tggtcggcta cgacctggtc gtcgccgaca ccgtcaacca cctgctgcgc       780
     ggcgtacgcc tcgccaccgg cgaggtggtc accgtggccg gcaccggccg gcagtggcgt       840
     tccaccgtgg atgaccacgc ccacgacgcc ctctcggtcg acctctcctc cccctgggac       900
     ctggcctggt acgacgaccg cctcgtgatc gccatggccg gcatccacca gctctggtgg       960
     ttcgacccgg tgaagcgcac caccggcatg tacgcgggca gcaccgtcga ggcccgcaag      1020
     gacgggccac tggccgaggc gtggctggcc cagccctccg gcctgtcggt ctccgccgac      1080
     ggcagccggc tctgggtggc cgacagcgag accagcgcgg tccggtacgt cgagaacggc      1140
     atcctgacca ccgcggtcgg gcaggggctc ttcgagttcg ggcacgttga cgggccggcg      1200
     gcgcaggcgc tactccagca tccgctgggg gtgtgcgcgt tgccggacgg atcggtgttg      1260
     atcgccgaca cgtacaacgg ggcggtccgc cgctacgacc cggagtcgga ctcggtgggc      1320
     acggtcgccg acgggctcgc cgagccgagc gacctgctgc tcaccccgga cggcggggtg      1380
     ctggtcgtgg agtccgccgc ccaccggctg acccggctcg cgccgggcgc gctcaccgcc      1440
     gccggggcca gcaccgtcaa cggcccgcgg caccgcaccg agcggaagcc gaccgaactg      1500
     cgagccggcg cggtgaccct ggaggtcatc ttcaccccgg cacccggtca gaagctcgac      1560
     gacagctacg gcccgtccac ccggctggtg gtctcggcgt ccccgccgga gttgctcctg      1620
     tccggcgcgg gcaccagcac cgagctgtcc cgcgagctgg tgatcagcga ttcggtccct      1680
     gaaggcgtgc tccaggtgac tgcccaggcg gcgacctgtg acgccgacgt ggcgcacgcc      1740
     gcgtgccacc tgacccggca ggactggggt gtgccgatct gggtggtcga cgatgccgcc      1800
     gaccggctcc cactggtgct gcgcggcatg gacgcctga                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page