(data stored in ACNUC7421 zone)

EMBL: CP000667.PE107

CP000667.PE107       Location/Qualifiers
FT   CDS_pept        complement(115228..116691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0107"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52592"
FT                   /db_xref="GOA:A4X142"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4X142"
FT                   /protein_id="ABP52592.1"
FT                   /translation="MSRVKEFNLPDLGEGLTEGEILSWLVKVGDTIELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQSIFHAEGATVEVGTPIIAIDTDPTAGPLATPEPTGGTAKASSAAA
FT                   SAAVEAPRGSTESGQNGDATSGGRTPVLVGYGPRTTAAKRRPRKGTAPAAPAAPARPTP
FT                   VPAQPTPVPVATGPTPGSGRSGPAGGTPVLAKPPVRKLAKDLGVDLSTVTGSGPLGSIS
FT                   REDVRQAASATPTTAEPLAAAVPVGSTTANVGAHREQRIPVKGVRKLTAENMSRSAFTA
FT                   PHVTEFLTVDMTRAMKALDRLRQRREWRDVRVSPLLLVAKAVLLAVRRHPMVNSTWAGD
FT                   EIVVKDYVNLGIAAATERGLIVPNVKDAGRLTLRELADSLTDLVQTAKAGKTSPGDMSG
FT                   GTLTITNVGVFGVDTGTPILPPGESAILAFGAVRKMPWVHKGKVRPRQVTTLGLSFDHR
FT                   IIDGELGSRFLRDIGDFLADPEAALLAWT"
     atgtcacgag tcaaggaatt caacctgccc gacctgggcg agggcctgac cgagggggag        60
     atcctcagct ggctcgtcaa ggtgggcgac accatcgagc tgaaccagcc catcgtcgag       120
     gtggagaccg ccaaggcagc ggtcgagatc ccggcgaagt gggccggccg ggtgcagtcg       180
     atcttccatg cggagggcgc gaccgtcgag gtcggaacgc cgatcatcgc gatcgacacc       240
     gacccgaccg ccggcccgct ggcgacaccg gagccgaccg gcggcaccgc gaaggcctcg       300
     tcggccgccg cgtccgcggc ggtggaggcc cccaggggct cgaccgagtc cggccagaac       360
     ggcgatgcca cgtccggtgg gcgcactccg gtgctggtgg gctacggccc gcgtaccacc       420
     gccgcgaagc gccgcccccg gaaggggacc gcgccggccg ctccagccgc tccagcccgg       480
     ccgacccccg taccggccca gccgaccccc gtaccggtgg ccaccgggcc tacccccggt       540
     agcgggcgca gtggtccggc cggcggtact ccggtgctgg ccaagcctcc ggtacgcaaa       600
     ctcgcgaagg atctcggggt cgatctgtcc actgtgaccg gatccggtcc gctcggctcg       660
     atcagccggg aggacgtacg gcaggcggcg agcgccaccc cgacgacggc tgaaccgttg       720
     gcggcggccg tgccggtcgg tagcacgacg gcgaacgtcg gtgcacatcg cgagcagcgg       780
     atcccggtca agggagtccg gaagctgacc gcggagaaca tgtcccgctc ggcgttcacc       840
     gcgccacacg tgacggagtt cctgaccgtc gacatgaccc gggcgatgaa ggccctggac       900
     cggctccgcc agcggcggga gtggcgggat gtccgggtct ccccgctgct gctggtcgcc       960
     aaggccgtgt tgttggcggt ccggcgccac cccatggtga actcgacctg ggcgggcgat      1020
     gagatcgtcg tcaaggacta cgtcaatctc ggcatcgcgg cggcgaccga gcgcggcctg      1080
     atcgtgccga acgtgaagga cgcggggcgg ctcaccctgc gggagctggc ggactcgctg      1140
     accgatctcg ttcagaccgc caaggccggg aagacctcac cgggagatat gtccggcggc      1200
     acgttgacca tcaccaacgt tggggtcttc ggtgtggata ccggtacgcc gattctgccg      1260
     ccgggtgagt cggcgatcct ggccttcggc gcggtccgca agatgccgtg ggtacataag      1320
     ggcaaggtcc gccctcgcca ggtcaccaca cttggcctct cgttcgacca tcggatcatc      1380
     gacggggagc tcggctcgcg gttcctgcgg gacatcggcg acttcctcgc cgatccggag      1440
     gcggcgctgc tcgcctggac ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page