(data stored in ACNUC7421 zone)

EMBL: CP000667.PE11

CP000667.PE11        Location/Qualifiers
FT   CDS_pept        13951..14319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0011"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52496"
FT                   /db_xref="GOA:A4X0U6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U6"
FT                   /protein_id="ABP52496.1"
FT                   /translation="MLNHLGIQVCDLDASLAFYDAVLAPLDGHRLMEFPEAVGYGSSTP
FT                   DFWLSPLSGAPGGVESHIAFTAPDRAAVQAFHDAAVALGAEVLHAPRVWPEYHPTYFGA
FT                   FVRDPDGNNVEAVCHRPE"
     gtgctcaacc acctcggcat tcaggtgtgc gatctcgacg ccagtcttgc cttttacgat        60
     gctgtcctgg ccccacttga tgggcatcgc ctgatggagt tcccggaggc ggtcggctat       120
     ggcagcagca ctcccgactt ctggctcagc ccgctgagtg gcgcgcccgg gggagtcgag       180
     tcgcacatcg ccttcaccgc gcccgaccgg gctgccgtgc aggcgttcca cgacgccgca       240
     gtggcgctcg gggcggaggt gctccatgcg ccccgggtct ggccggaata tcacccgaca       300
     tacttcggtg ctttcgtccg cgatccggat ggaaacaacg tcgaggcggt ctgccatcgg       360
     ccagagtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page