(data stored in ACNUC7421 zone)

EMBL: CP000667.PE115

CP000667.PE115       Location/Qualifiers
FT   CDS_pept        124781..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0115"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52600"
FT                   /db_xref="GOA:A4X150"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X150"
FT                   /protein_id="ABP52600.1"
FT                   /translation="MSSKDWIEKDFYAALGVGKAASADEIKKAYRQLARESHPDRNPGD
FT                   AKAEERFKAASEAYTVLGDDAKRREYDEMRSLFGSGAFRRNARGAGQSGGAPFDVGDLF
FT                   GGAAGGDRRFSGAGFQDLFGSIFPGGGGTASRGPARGRDVETEVALDFGDAIRGVTLPL
FT                   TLRTPGVCDTCHGDGAKPGTQPRACPTCRGAGVTTRNQGSFSFSEPCSDCQGVGTVVDE
FT                   KCPECQGTGGVTKNRTLNVRFPAGVADGQRIRLAGRGEPGARGGPAGDLFIQVKVSPDD
FT                   LFGRAGDDLTLTVPITFAEAVLGTDLRVPTFDGAVTLRVPPGTPSGRVLRARGKGVVRT
FT                   AGRAGDLLVTLEVTVPAKLSEEARAALETFVAQTPPAAREHLDARVRRGS"
     gtgagttcca aggactggat cgagaaggac ttctacgccg cccttggcgt gggcaaggcc        60
     gcctctgctg atgagatcaa gaaggcgtat cggcagctgg cgcgcgagtc gcacccggat       120
     cgcaaccctg gcgacgcaaa ggccgaggag cggttcaagg cggcctccga ggcgtacacg       180
     gtgctcggcg atgacgcgaa gcgccgggag tacgacgaga tgcgttcgtt gttcggctcg       240
     ggcgcgttcc ggcgcaacgc ccgcggagcg ggccagtccg gcggggcgcc gttcgacgtc       300
     ggcgacctgt tcggtggcgc ggccggtggt gatcggcggt tcagtggagc agggtttcag       360
     gacctgttcg gttcgatctt tccgggtggg ggtgggaccg catcgcgtgg cccggctcgg       420
     ggacgggacg tggagaccga ggtcgcgctc gacttcggcg acgcgattcg cggggtgacc       480
     ctgccgctga cgttgcggac gccgggggtg tgtgacacct gtcacggcga cggggcgaag       540
     cccggcacgc agccgcgtgc ctgtccgacc tgtcgcggtg ccggcgtgac cacccgtaac       600
     caggggtcgt tcagcttctc cgagccctgc tccgactgcc agggcgttgg cactgtggtg       660
     gacgagaagt gcccggagtg tcagggcacc ggtggcgtca ccaagaaccg tacgttgaac       720
     gtccggttcc ccgccggggt ggccgacggt cagcggatcc ggctggccgg tcggggtgag       780
     cccggggcgc ggggcgggcc cgccggtgac ctgttcattc aggtcaaggt cagtccggac       840
     gacctgttcg ggcgagccgg agacgacctg acgctgacgg tgccgatcac cttcgctgag       900
     gcggtactcg gcaccgatct gcgggtaccc accttcgacg gcgcggtaac cctccgggtg       960
     ccgccgggta cgccgagcgg acgtgtcctc cgggcccggg gcaagggagt ggtccgtacc      1020
     gccgggcggg ccggtgatct gctggtcacc cttgaggtga cggtcccggc gaagctgtcg      1080
     gaggaggcgc gggcggcgtt ggagacgttt gtcgcccaga ccccgccggc tgctcgggaa      1140
     catctcgacg cgcgggtgcg tcgggggagc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page