(data stored in ACNUC7421 zone)

EMBL: CP000667.PE121

CP000667.PE121       Location/Qualifiers
FT   CDS_pept        129372..131963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0121"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52606"
FT                   /db_xref="GOA:A4X156"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4X156"
FT                   /protein_id="ABP52606.1"
FT                   /translation="MNTERLTTKSREAITGAVTLAGQRGHATVEPWHLLLSLLDTEGST
FT                   TVGLLRATGADPDDLRRAAERAVAALPVARGSSVAEPTLAREFVNAIGAAEQIARPLGD
FT                   EYTSTEHLLAGLAQVGGAVSAALRTAGVTEEALVASFPTVRGGDRRVTSADPEQTYQAL
FT                   AKYGVDLTASARDGRIDPVIGRDTEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVAGDVPESLRDKKLVSLDLGAMVAGASYRGQFEERLKSVLEEIKNSDGQVITFLDE
FT                   LHTVVGAGKGEGSMDAGNMLKPMLARGELRMVGATTLDEYREHIESDPALERRFQPVLV
FT                   GEPTLADTVGILRGLKERYEVHHGVRITDGALVAAATLSDRYITDRFLPDKAIDLVDES
FT                   ASRLRMEIDSRPVEVDEIERAVRRLEIEEMALAKEADAASAERLERLCKELADKREQLT
FT                   ALSERWQTEKRHITRLSTAKEDLERLSGEAERAERDGELERAAELRYGRIPALQADLTQ
FT                   AAEELTRLQADGAMLKEEVGADDIAAVVASWTGIPAGRLLEGETAKLLRMEESLGEQVV
FT                   GQARAVGAVADAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALAGFLFDDERAMV
FT                   RIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVILLDEVEKAHPDVFDL
FT                   LLQVLDDGRLTDGQGRTVDFRNAILILTSNLGSSMVGDLTVPEEQRREGVLAVVRSHFK
FT                   PEFLNRLDDTVVFAALRGEDLRAIVDIQLDRMRRRLADRRLGLEITEPARQWLAEHGYD
FT                   PVYGARPLRRLVQTAIGDQLAKALLAGRIRDGDTVRVGLADSEDALTVTAT"
     atgaacaccg aacgtctcac cacgaagagc cgcgaggcca tcaccggcgc cgtcaccctc        60
     gctggtcagc gcggacacgc caccgtggag ccctggcacc tactgctgtc cctgttggac       120
     accgagggat caaccacggt cggcctgctg cgcgctaccg gcgccgaccc tgatgaccta       180
     cgccgggccg ccgagcgcgc ggtagctgcg ctgcccgtcg cgcgcggatc cagtgtcgcc       240
     gagccgaccc tggcccggga gttcgtcaac gccatcggcg ccgccgagca gatcgcccgc       300
     ccactcggcg acgagtacac ctcgaccgag catctgctcg ccggtctggc ccaggtcggc       360
     ggcgcggtgt cggcggcgct gcggaccgcc ggggtcaccg aggaggccct ggtggcctcg       420
     ttcccgaccg tgcggggtgg agaccgtcga gtcaccagcg ccgacccgga gcagacctac       480
     caggccctcg cgaagtacgg cgtcgacctg accgccagtg cccgggacgg ccggatcgac       540
     ccggtgatcg gccgggacac cgagatccgt cgggtgattc aggtgctgtc tcggcggacg       600
     aagaacaacc cggtcctgat cggcgagccg ggtgtcggca agaccgcgat cgtcgagggc       660
     ctggcccagc ggatcgtcgc cggtgacgtc cccgagtcgc tacgggacaa gaagctggtc       720
     tccctggacc tcggcgcgat ggtggccggt gcctcatacc ggggtcagtt cgaggagcgg       780
     ctgaagtccg tcctcgagga gatcaagaat tcggatggcc aggtcatcac cttcctggac       840
     gaactgcaca ccgtcgtcgg tgccggcaag ggtgagggct cgatggacgc cggcaacatg       900
     ctcaagccca tgctggcccg gggtgagctg cggatggtcg gcgcgaccac actggatgag       960
     taccgtgagc acatcgagtc cgacccggcc ctggaacgcc gcttccagcc ggtgctggtc      1020
     ggtgagccga ccctcgcgga caccgtcggc atcctgcggg gcctcaagga gcggtacgag      1080
     gtgcaccacg gggtgcggat caccgacggt gcgctggtcg ccgccgcgac cctgtccgac      1140
     cgatacatca ccgaccggtt cctgccggac aaggccatcg acctggtcga cgagtccgcg      1200
     tcccggctcc gaatggagat tgactcccgg ccggtcgagg tggacgagat cgagcgggcg      1260
     gtgcgccggc tcgagatcga ggagatggcg ctggcgaagg aggcggacgc cgcctccgcc      1320
     gagcggctgg agcggctgtg taaggaactg gccgacaaac gtgagcagct caccgccctc      1380
     tccgagcgct ggcagacgga gaagcggcac atcacccgac tgtcgaccgc caaggaggac      1440
     ctggaacgtc tcagcgggga ggccgagcgg gcggagcgtg acggcgagct ggaacgcgcc      1500
     gccgagttgc ggtacgggcg tatcccggcg ctccaggcgg acctgaccca ggcagcggag      1560
     gagctgaccc ggctccaggc ggacggcgcg atgctcaagg aggaggtcgg cgcggacgac      1620
     atcgccgccg tggtggcctc ctggaccggc attcccgccg ggcggctcct cgagggcgag      1680
     acggcgaagc tgctccggat ggaggagtcg ctgggtgagc aggtggtcgg tcaggcccgc      1740
     gcggtgggtg ctgtcgccga cgcggtccgc cgggcccgcg ccggcatcgc ggacccggac      1800
     cgcccgaccg gcagcttcct gttcctcggc ccgaccggtg tcggcaagac cgagttggcc      1860
     aaggcgctcg ccgggttcct cttcgacgac gagcgggcga tggtacgaat cgacatgagc      1920
     gagtacgggg agaagcactc cgtcgcccgc ctcgtcggcg ccccacccgg ctacgtcggg      1980
     tacgaggagg gcggccagct caccgaggcg gtacgccgtc ggccgtactc ggtgatcctg      2040
     ctcgacgagg tggagaaggc ccacccggac gttttcgatc ttctcctcca ggtgctcgac      2100
     gacggccggc tcaccgacgg tcagggccgg acggtggact ttcgaaacgc catcctgatc      2160
     ctcacctcca acctcggctc gtcgatggtg ggtgacctca ccgtgccgga ggaacagcgc      2220
     cgcgagggcg tcctggcggt ggtccggtcg cacttcaagc cggagttcct caaccgcctc      2280
     gacgacaccg tggtcttcgc cgccctgcgg ggcgaggact tgcgggccat tgtcgatatt      2340
     cagctggacc ggatgcgccg ccggctcgcc gaccgtcggt tgggcctgga gatcaccgaa      2400
     ccggctcggc agtggctcgc cgagcacggc tacgacccgg tctacggcgc ccgcccactg      2460
     cgtcgcctgg tgcagaccgc catcggcgac cagctggcca aggccttgct ggccggccga      2520
     atccgcgacg gtgacaccgt ccgggtgggc ctggcggaca gcgaggacgc cctcaccgtg      2580
     accgccacgt ag                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page