(data stored in ACNUC7421 zone)

EMBL: CP000667.PE122

CP000667.PE122       Location/Qualifiers
FT   CDS_pept        132049..133014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52607"
FT                   /db_xref="GOA:A4X157"
FT                   /db_xref="UniProtKB/TrEMBL:A4X157"
FT                   /protein_id="ABP52607.1"
FT                   /translation="MVLLQRIRQQAVGSAVARWFARCEVLVRGAGDGLAVRELLRYPDV
FT                   RRITVGASYRRACCPRSYGVGANEGRRLVANPQQPVRVRPGVVTISSYLLIFYAVLTAI
FT                   AVVVGLATLGTLQDVYQESFAGTDAEGAEGFVVLVAVATSLVSLLFAVGLVVLALLNNR
FT                   GKNTPRIITWVVGGIALCCAGVGLAFSAAGSAVDGEGSGDVVSQEEINRRLEEALPSWY
FT                   EPVTNLITVLGAIALLVALILLALPKSNEFFRKPQQQWEPPVPGAVYPGTPGGPAYPMT
FT                   PGQPGYPQADPSSGSSGQSGSPGQSGSSGHSGSSDPGGER"
     atggtgctgc tgcaacggat ccgccagcag gcagtcggca gtgcggtcgc gcgctggttc        60
     gcgcggtgtg aggtgctcgt gcggggtgcc ggggacgggc tcgcggttcg ggaactgctg       120
     cgctacccgg atgtacgtcg gatcaccgtg ggagcctcgt atcgtcgagc ttgttgcccg       180
     aggtcgtacg gtgtgggcgc gaatgaggga aggagactcg tggcaaatcc gcaacagccc       240
     gtacgggtac gtccgggcgt cgtaaccatt tccagttatc tacttatttt ctatgccgtc       300
     ctgaccgcga tcgccgtggt cgttgggctc gccaccctgg gtacgctgca ggacgtctac       360
     caggagtcct ttgctgggac cgatgccgag ggcgccgaag gcttcgtggt gctcgtggcc       420
     gtcgcgacga gcctggtcag cctgctcttc gcggtggggc tggtcgttct cgccctgctc       480
     aacaaccggg gaaagaacac gccccggatc atcacctggg ttgtcggcgg catcgcgctc       540
     tgctgcgccg gggtcggcct ggccttctcc gcggcgggta gcgccgtaga tggcgagggc       600
     tccggagacg tggtcagtca ggaggagatc aaccgtcggc tggaagaagc cctgccgtcc       660
     tggtacgaac cggtaacgaa cctgatcacg gtgctcggcg ccatcgccct gttggtggct       720
     ctgatcctgc tcgcgctgcc gaagtcgaac gagttcttcc gcaagccgca gcagcagtgg       780
     gagcccccgg tcccgggcgc tgtctacccc gggaccccgg gcgggccggc gtaccccatg       840
     accccggggc agccgggcta tccgcaggcc gatccgagtt cgggttcctc ggggcagtct       900
     ggctccccgg ggcagtctgg ctcctcgggg cactcgggtt cgtcagaccc gggtggagag       960
     aggtag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page