(data stored in ACNUC7421 zone)

EMBL: CP000667.PE123

CP000667.PE123       Location/Qualifiers
FT   CDS_pept        133124..133729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52608"
FT                   /db_xref="GOA:A4X158"
FT                   /db_xref="UniProtKB/TrEMBL:A4X158"
FT                   /protein_id="ABP52608.1"
FT                   /translation="MSYPEPARRPAAVTAAVVLLALMAVVAVAYAVAGLFVLFGTVDAF
FT                   RLAAAGSAASSDEVDAMVLLVSVWTVAGVVASLLAGVLLAALAGVVRTGRSGARVATWV
FT                   VAGLGVLAGCCGLTVLSGMRVFPMRLGDEDRSTVELLAQLSEAYPDWWIPLGAGLSVGQ
FT                   VLGYFVVALLLALPTAATWFRQPRPSLHVPYPPPHPPR"
     gtgtcgtacc ccgaaccggc ccgccgcccc gctgcggtga ccgcggctgt cgtgctgctg        60
     gcgctgatgg cggtggtcgc cgtcgcgtac gccgttgccg gcctgttcgt tctgttcggc       120
     acggtcgatg ccttccggtt ggcggcggcg ggaagcgcgg cctcgtcgga cgaggtcgat       180
     gcgatggtcc tgttggtcag cgtctggaca gtggccggcg tggtggccag cctgctcgcc       240
     ggggtgctgt tggccgcgct tgccggggtc gtacgcactg gccgttccgg tgcgcgggta       300
     gcgacctggg tggtcgccgg gctgggggtg ctcgccggct gctgtgggct caccgtcctg       360
     agcgggatgc gggtcttccc catgcgactg ggcgacgagg atcgctccac ggtcgagctc       420
     ctcgcccaac tgtccgaggc ctacccggac tggtggattc cgctcggcgc aggtctttcg       480
     gtcgggcagg tgctcggtta ctttgtggta gcgctgttgc tggccttgcc gacagcagcc       540
     acctggttcc gccagcctcg gccctccctg cacgtgccgt atccgccccc gcatcccccg       600
     aggtga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page