(data stored in ACNUC7421 zone)

EMBL: CP000667.PE128

CP000667.PE128       Location/Qualifiers
FT   CDS_pept        complement(136796..138352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0128"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52613"
FT                   /db_xref="GOA:A4X163"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A4X163"
FT                   /protein_id="ABP52613.1"
FT                   /translation="MLKHPTRRWLAGIGLAGALVATATPASAAETDITLDVYFDNVTLA
FT                   AGSAGKDRASIISASAPVTLHDLTAQYDFSDLAGKVDVSSESLGNDCTTPEPHVLRCVN
FT                   PFPDTIEDSRGAYRVLLVPTAAAANGDEGVLKVSISAQGFSPVTHDATVRIGAGVDLVA
FT                   GAEHEFSVAPGETFTEPLTVSNAGEVTADGAVAFFDHDYGIRADQRYSNCNYDGDHLVF
FT                   CRFDEKLTPGASYSAPLTHTLGSDTYAPSFVHGNVYWQTPAEFEAYEARLHRMGISLGE
FT                   PGTGGKLTLTEQNRIQSARGAQADPDPSNNWSYLDISATGSNGTDLEAIGTEVSGEKAA
FT                   EVQARIGFRNNGPATLDYTRPGSSVTYLNVDVPEGTTAVKVPDLCSPLLGDEFGDRGEA
FT                   GAANYRCYVSSFSKVGEQQTFDFTLRIDEVIADAAGAVKVNVPCRCEGGFYDDIEPAND
FT                   EAAILVNATGGGGGGGNGEDPSLPITGSSTTLVAGLGGLLLATGAAGFLVTRRRRNNFV
FT                   A"
     atgctcaaac accccacccg gcgctggctc gccgggatcg gcctcgccgg cgcgctcgtc        60
     gccactgcca ctcccgcctc ggcggccgag accgacataa cgctcgacgt ctacttcgac       120
     aacgtcaccc tcgccgccgg ctccgccggc aaggacaggg cgtcgatcat ctccgcctcg       180
     gcgccggtca ccctgcacga cctgaccgcc cagtacgact tcagcgacct cgccggcaag       240
     gtcgatgtct cctcggagag cctgggcaac gactgcacca ccccggaacc acatgtgttg       300
     cgctgcgtca accccttccc cgacaccatt gaggacagcc gaggcgccta cagggtgctt       360
     ctcgtgccca ccgccgccgc cgcgaacggc gatgaggggg tgctgaaggt cagcatcagc       420
     gcccagggct tctcacctgt cacccacgac gcgacggtac gtatcggcgc cggagtcgat       480
     ctcgtcgccg gagcagagca cgagttctcc gtcgcacccg gcgagacgtt cacggaaccg       540
     ctgacggtca gcaacgctgg cgaggtcact gccgacgggg cggtcgcgtt ctttgaccac       600
     gactacggga tccgggctga ccagcgctac agcaactgca actacgacgg cgaccacctg       660
     gtcttctgcc gcttcgatga gaagctgacg ccgggggcca gctacagcgc ccccctcacc       720
     cacacgctcg ggtcggatac ctacgcgccg agcttcgtac acggcaatgt ctactggcaa       780
     acgccggccg agttcgaggc ctacgaggca cgtctgcacc gcatgggtat ctccctggga       840
     gagcccggca ccggtgggaa gctcacgctg accgagcaga accgcatcca gtcggctcgc       900
     ggggcgcagg ccgatcccga cccgtcgaac aactggtcct acctggatat ttctgccacc       960
     ggtagcaacg gcaccgacct ggaggcgatc ggcaccgagg tctccgggga gaaagccgcc      1020
     gaggtccagg cgagaatcgg cttccgcaac aacggtccgg ccacccttga ctatactcgg      1080
     cccggctcgt ccgtgaccta cctcaacgtc gacgtcccgg agggcaccac ggcggtcaag      1140
     gtgcccgatc tctgctcgcc cttgctcggt gacgagtttg gtgaccgggg tgaagcgggg      1200
     gcagcgaatt accgctgcta cgtctcctcc ttcagcaagg tcggcgagca gcagacgttc      1260
     gacttcaccc tccggatcga cgaggtcatc gcggacgctg ccggcgcggt gaaggtcaac      1320
     gtgccctgcc gctgcgaggg cggcttctac gatgatatcg agccggccaa cgacgaagcc      1380
     gcgatcctgg tcaacgcgac cggtggcggc ggtggcggcg gcaacggcga agacccgagc      1440
     ctgccgatca ccggtagctc gacaacgttg gtagctggcc tcggcggcct gctgctcgcc      1500
     actggtgcgg ccggcttcct ggtgacccgc cgccgacgga acaatttcgt cgcctga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page