(data stored in ACNUC7421 zone)

EMBL: CP000667.PE138

CP000667.PE138       Location/Qualifiers
FT   CDS_pept        149485..150141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0138"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52623"
FT                   /db_xref="GOA:A4X173"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A4X173"
FT                   /protein_id="ABP52623.1"
FT                   /translation="MSSTPTFRRLPRAVREQQMLDAAVKVFSRRGYHGASMDEIADDAG
FT                   ISKPMVYAYLGTKEELFVACLHREGNRMTQAVTSAVAPDLSADERLWRSLRAFLGFVGA
FT                   HRDGWAVLYRQARGEQPFAGEIAAMRRRIVEVVTELLDHTLRAEGREAAEVELEVAAYA
FT                   LVGATESVADWLVDHPEADPEQTATRMMNVAWVGAAQLLAGTSWRPPIRRGEAPS"
     gtgtccagta cccccacctt ccggcgtctg ccccgagccg tccgggagca acagatgctc        60
     gatgccgcgg tcaaggtctt ctcccggcgg ggctaccacg gggccagcat ggacgagatc       120
     gccgacgacg ccggcatctc taagccgatg gtgtacgcgt acctgggcac caaggaggag       180
     ctcttcgtcg cctgcctgca ccgcgagggc aaccggatga cgcaggccgt taccagcgcc       240
     gtcgcccccg acctgtcggc cgacgagcgg ctctggcgga gtctgcgggc cttcctcggc       300
     ttcgtcggcg cgcaccgcga cggctgggcg gtgctctacc ggcaggcccg cggcgagcag       360
     cccttcgccg gagagatcgc cgcgatgcgg cgacggatcg tcgaggtcgt caccgagctg       420
     ctcgaccaca ccctgcgtgc cgagggacgc gaggcggccg aggtcgagct ggaggtcgcc       480
     gcgtacgccc tggtcggcgc gaccgagtcg gtcgccgact ggctggtcga ccacccagag       540
     gcagacccgg agcagaccgc cacgcggatg atgaacgtcg cctgggtcgg cgccgcgcaa       600
     ctgctcgccg ggaccagctg gcgccctccc atccggcggg gcgaggcccc ctcctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page