(data stored in ACNUC7421 zone)

EMBL: CP000667.PE139

CP000667.PE139       Location/Qualifiers
FT   CDS_pept        complement(150162..150779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0139"
FT                   /product="Uncharacterized membrane-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52624"
FT                   /db_xref="GOA:A4X174"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4X174"
FT                   /protein_id="ABP52624.1"
FT                   /translation="MESALDLLRQLITSPLVYLLLFALTAVDAVLPMVPAETAVITAAV
FT                   LVGGDTPQLAGIWAAATLGAMAGDHAAYVIGRGGGARRLARFPAESRRRASSEWARRAL
FT                   HRRGGLVLTTARYVPGGRTAVTLTMGAVRYPLRSFLLFDAIGAASWALYSVLLGYFGGL
FT                   AFQQDPLRGVLAGLALSLGVTGLLELARRLRQRSRRRAAARR"
     atggagtccg cgctcgacct gctgcggcag ttgatcacct cacccctggt gtatctcctg        60
     ctgttcgcgc tcaccgcggt cgacgcggtc ttgcccatgg tgccggccga gacagcggtg       120
     atcaccgcgg cggtactcgt cggcggtgac acgccgcagc tggcaggaat ctgggccgcc       180
     gccaccctcg gcgcgatggc tggcgaccac gccgcgtacg tgatcggacg gggcggtggc       240
     gcgcggcggc tcgccaggtt tccggcggag agccggcgga gagccagttc ggagtgggcc       300
     cgacgggcgt tgcaccgccg gggtgggctg gtcctcacca ccgcccgcta cgtccccggc       360
     gggcggacgg cggtaaccct gacgatgggg gcggtgcgct atccactgcg atcgttcctg       420
     ctctttgacg cgatcggcgc ggcgagctgg gcgttgtaca gcgtgctgct gggctacttc       480
     ggcgggctgg cgttccagca ggacccgctg cgtggcgtgc tcgccggcct ggctctgtcg       540
     ctcggggtga ccggcctgct cgagttggcg cggcggctac gccagcgctc gcgtcgccgg       600
     gccgctgccc gtcggtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page