(data stored in ACNUC7421 zone)

EMBL: CP000667.PE140

CP000667.PE140       Location/Qualifiers
FT   CDS_pept        complement(150848..151741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0140"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52625"
FT                   /db_xref="GOA:A4X175"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X175"
FT                   /protein_id="ABP52625.1"
FT                   /translation="MAGPQEPSDAGQVSRSRVQLAVLPTVGALYRRALLGALPGSGSRR
FT                   AEQPPTVELGVDGVPIDRGRLAAYDRVCGFRLTDRLPATFPHVMGFPLALRLMTAPDFP
FT                   IPLAGVVHVGNRITVHRPIDAAETLDFVAYATNLRPHDRGRQIDVVLVGRVGGEEVWRG
FT                   VSTYLGREQTPGGGERANRGDPPPAPHAWARWRLERQVGTAYAQVSGDHNPIHTSRLGA
FT                   RLFGFRRPIAHGMWSKARCLAALEPRLPDAYTVDVAFKLPVPLPGTVAFGSTSAGDFAL
FT                   HDTRDRPHLVGTFRER"
     atggcaggtc cgcaggagcc atccgacgcc gggcaggtca gtcggtcccg ggtccagctg        60
     gcggtgctgc cgacggtcgg cgcgctctac cgccgtgcgc tactcggcgc gctgcccggg       120
     agtgggtcgc ggcgggccga gcagcccccg acggtcgagc tgggggtgga cggagtcccc       180
     atcgaccggg ggcgtctcgc cgcctacgac cgggtctgcg ggttccggct caccgaccgg       240
     ctgcctgcga cgttcccgca cgtgatgggt ttcccgctgg cgctgcgcct gatgaccgcg       300
     ccggacttcc cgatcccact cgccggcgtg gtccacgtcg gcaaccggat caccgtccac       360
     cgcccgatcg acgccgccga gacgctcgac ttcgtcgcgt acgcgacaaa cctgcgcccg       420
     cacgaccggg gccggcagat cgacgtggtg ctggtgggca gagtcggcgg ggaggaggtc       480
     tggcgcggcg tctccaccta cctgggccgg gagcagacgc ccggcggtgg cgaacgagcg       540
     aaccggggtg acccgccccc ggcgccgcac gcctgggcac gctggcgcct cgagcgccag       600
     gtcgggaccg cgtacgccca ggtctccggt gaccacaacc cgatccacac ctcccggctc       660
     ggcgcgcggc tcttcggctt ccggcgcccg atcgcgcacg gcatgtggag caaggcccgc       720
     tgcctggctg cgctggagcc gcggctgccg gacgcgtaca ccgtcgacgt ggcgttcaag       780
     ctgccggtgc cgctgcccgg caccgtcgcc ttcggcagca cctcggcggg cgacttcgcg       840
     ctgcacgaca cgcgggaccg ccctcacctc gtcggcacgt tccgggagcg gtaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page