(data stored in ACNUC7421 zone)

EMBL: CP000667.PE143

CP000667.PE143       Location/Qualifiers
FT   CDS_pept        complement(154472..154981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52628"
FT                   /db_xref="UniProtKB/TrEMBL:A4X178"
FT                   /protein_id="ABP52628.1"
FT                   /translation="MASGAAAHLRLAPPPRGHLVTAGLPFGVGSVVQLAEQHYCYGLGT
FT                   LTLRIVEVGRRVRRTDGLWIHMRGVQLGSPPRQRRVLARLDAIQTQPVPIPVTHIPVRP
FT                   GWDCAGCGAAWPCPDRRRRLLDRYAGNPAALGIYLSTQMTAAVPDLRHLPPEELYERFL
FT                   GWLRLA"
     gtggcgtcgg gcgccgctgc tcaccttcgc ctggctcctc cgcctcgggg tcatctcgtg        60
     accgccggcc tgcccttcgg cgtgggtagc gtggtgcagc ttgctgaaca acactactgc       120
     tatggcctgg gcaccctgac cctgcgcatc gtcgaggtgg gacgtcgggt acggcgcacg       180
     gacgggctct ggatccacat gcgtggcgtt caactcggaa gcccgccacg ccagcgacgg       240
     gtcctggccc gcttggacgc catccagacg cagccggtac ccatcccggt cacgcacata       300
     ccggtccgac cgggatggga ctgcgccggc tgcggggcgg cgtggccctg cccggaccgt       360
     cggcgacgcc tactcgaccg gtacgcgggc aaccccgcag cgctcggcat ctacctgagc       420
     acacagatga cggcagcggt acccgacctg cgtcaccttc cacccgagga gttgtacgaa       480
     cggttcctgg gctggctgcg actggcctaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page