(data stored in ACNUC7421 zone)

EMBL: CP000667.PE145

CP000667.PE145       Location/Qualifiers
FT   CDS_pept        156051..156764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0145"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52630"
FT                   /db_xref="GOA:A4X180"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X180"
FT                   /protein_id="ABP52630.1"
FT                   /translation="MASGSDSRPRHEQVAADLRSRIMSGELPPGSALPSIPTLVRQYSA
FT                   ATATVQRALGALKAEGSVYSEVGKGVYVRPRRPLVVEASAYLAPTSDGYAYRLRSVAEV
FT                   VPPAEVARELEIGADERAVLRHRLLVCGDEPVELSWSYYPAAIASGTELAERRKIPGGA
FT                   PRALADLGYPQRHTRDRVCARMPTTEEVEALDLPPYVPVLRQLRVIRSVDARPVEVSIL
FT                   VKGSHRHELHYDQRG"
     atggcgagtg gatccgacag ccgtccccgt catgagcagg tcgcggccga ccttcggtcc        60
     cgcatcatgt ccggcgagtt gccgccgggg tcagcgctgc cgtcgatccc gacgctcgtg       120
     cggcagtact ccgcggccac cgcgacagtc cagcgtgccc tcggtgcgct gaaggcggag       180
     ggctctgttt acagcgaggt gggaaagggc gtctacgtcc gaccgaggcg accgctggtg       240
     gtggaggcgt cggcttacct cgctcccacc tccgacgggt acgcctaccg gctccgctcg       300
     gtggcagagg tggtgccgcc cgccgaggtg gcgcgggaac tggagatagg tgcggacgaa       360
     cgagcggttc tgcggcatcg gctgctcgtg tgtggtgatg agccggttga gctgtcctgg       420
     tcgtactatc cggcggccat cgccagtggc acggagctcg ccgagcggcg caagatcccg       480
     ggtggtgctc cgcgggctct ggcagatctt ggctacccgc agcggcatac gcgggaccgg       540
     gtttgcgcgc ggatgcccac gacggaggag gtcgaagcgc tcgacctgcc gccgtacgta       600
     ccggtgctcc gccagctacg ggtgatccga tcggtcgacg ccagaccggt cgaggtgtcg       660
     atcctcgtca agggcagcca ccggcacgag ctgcactacg accagcgggg gtag             714
//

If you have problems or comments...

PBIL Back to PBIL home page