(data stored in ACNUC7421 zone)

EMBL: CP000667.PE157

CP000667.PE157       Location/Qualifiers
FT   CDS_pept        172280..172516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52642"
FT                   /db_xref="UniProtKB/TrEMBL:A4X192"
FT                   /protein_id="ABP52642.1"
FT                   /translation="MPENTGPRQPERTAGAVSDDVVDRIRVAGADLTTLLREAEAARHL
FT                   RAEAAGDGTSSAVCAWNHFENIPTFYNWNNRPR"
     atgcccgaga acaccggtcc ccggcaacct gagcgcacgg cgggcgcggt ctcggacgac        60
     gtggtcgatc ggatccgcgt cgctggcgcc gacctcacca cgttgcttcg cgaggccgag       120
     gcggcccgcc acctacgggc ggaggcggcg ggagacggca cctccagcgc ggtctgcgcc       180
     tggaaccact tcgagaacat cccgacgttc tacaactgga acaaccgtcc acgctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page