(data stored in ACNUC7421 zone)

EMBL: CP000667.PE16

CP000667.PE16        Location/Qualifiers
FT   CDS_pept        19204..20175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0016"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52501"
FT                   /db_xref="GOA:A4X0V1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V1"
FT                   /protein_id="ABP52501.1"
FT                   /translation="MSTPRVLPADRGVAEAAAVLRAGGLVALPTETVYGLGANALDAPA
FT                   VARIFAAKARPSFDPLISHLAEAAELEKLVGTVPAAVAELAERFWPGPLTLIVDRPAVI
FT                   PPIVTSGLETMAVRVPDHAATRGLIAAAGVPVAAPSANRFGQLSPTRAEHVVAGLGAAV
FT                   DVVLDGGPTRCGIESTIVDARGDRPVVLRLGALPVELLQEAVGPVLVRAGSSGQPVAPG
FT                   TLAAHYAPRTRLRLATDTDPADGGVSRQGFLGFRGCPAGDWAAVEVLSSKGDLTEAAAR
FT                   LFDALHRLDGAGVDEILVESVPEVGVGRAINDRLRRAAATWT"
     gtgagtacgc cgcgagtact gcccgctgac aggggtgtcg ccgaagccgc cgccgtcctg        60
     cgggccggcg gtctggtggc cctgcccacc gaaacggtgt acggcctggg cgcgaacgcg       120
     ctggacgccc cggcggtggc ccggatcttc gcagccaagg cgcggccgag ctttgatccg       180
     ctgatcagtc acctggccga ggcggcggag ctggaaaagc tggtaggtac ggtgccggcg       240
     gcggtggcgg agctggccga gcgattctgg cccgggccgc tgacgctgat cgtggaccgg       300
     ccggcggtga ttccgccgat cgtcacctcc gggctggaga cgatggcggt gcgggtgccg       360
     gaccatgcgg cgacgcgcgg gttgatcgcg gcggcggggg tgccggtggc ggcaccgagc       420
     gcgaaccggt tcggtcaact cagcccgacg cgggccgagc acgtcgtggc ggggctgggg       480
     gcggcggtcg acgtggtgct cgacggtggg ccgacccggt gtgggatcga gtcgacgatc       540
     gtggacgcgc gaggagaccg tccagtggtg ctgcggttag gtgcgctgcc ggtggagttg       600
     cttcaggagg cggtcggtcc ggtactggtc cgggcgggca gttcggggca gccggtggcg       660
     ccggggacgc tggccgcgca ctacgccccg cgtacgcgac tgcggttggc caccgatacc       720
     gatccggcgg acggcggtgt ttcccggcag gggttcctgg gcttccgcgg ctgtccggcg       780
     ggggactggg cggcggtgga ggtgctgtcc agcaagggcg acctgaccga ggcagcggcc       840
     cggttgttcg acgcgctgca tcgactggac ggggccggtg tcgacgagat cctggttgag       900
     tcggtgcccg aggtgggggt tggccgggcg atcaacgacc ggttgcgccg cgccgccgct       960
     acctggacgt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page